KEGG   Nicotiana sylvestris: 104210270Help
Entry
104210270         CDS       T05026                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00970  Aminoacyl-tRNA biosynthesis
nsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104210270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nsy03029]
    104210270
Enzymes [BR:nsy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     104210270
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     104210270
Mitochondrial biogenesis [BR:nsy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    104210270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 104210270
NCBI-ProteinID: XP_009757430
UniProt: A0A1U7V6S7
Position
Unknown
AA seq 141 aa AA seqDB search
MGSSIKALHLLKPATDSFFFSFTKNGISSLPLSIKQRRSYSMKSSVLEPPDVPRLAETAR
ISLIPQQVEEFAPKIRQVIDWFGQLQAVDLQSIEPALRADTEGDNLRDDVPEKFENREAL
ISVVPSFEEPYIKVPKVLNKE
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcagcatcaaagctttgcatttgctgaaaccagccactgattctttcttcttc
agtttcactaaaaatggcatttcctcattaccactgtctattaagcagcgaagaagctac
tctatgaaatcgagtgttctagagcctcccgatgttcctcgtttggctgaaactgctcga
atttcactcatccctcaacaagttgaagaatttgctcccaaaattcgacaagttatagat
tggtttggacaacttcaagctgttgatctgcagagtatcgagccagccttaagggcagat
actgagggagataatttgcgcgatgatgtacctgaaaagtttgagaatagggaagcattg
atttctgttgtgccaagctttgaggagccttacatcaaagttcccaaagtgttgaataag
gagtaa

DBGET integrated database retrieval system