KEGG   Nicotiana sylvestris: 104211704Help
Entry
104211704         CDS       T05026                                 

Definition
(RefSeq) uncharacterized protein LOC104211704
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
nsy  Nicotiana sylvestris
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nsy01001]
    104211704
Enzymes [BR:nsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104211704
Protein kinases [BR:nsy01001]
 Serine/threonine kinases: TKL group
  IRAK family
   104211704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung APH Haspin_kinase TMEM154 PRIMA1 ABC1 Pkinase_fungal DUF4448 DUF1180 CcmH Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 104211704
NCBI-ProteinID: XP_009759100
UniProt: A0A1U7VB97
Position
Unknown
AA seq 1351 aa AA seqDB search
MWMGKTDMSFLTWLGIILIFHFYYLFYLSIAQPNFAFQSPCEGNETEYSPNGAYGTNLNT
VLSSLSRNIDSDGFYNTSIGQDPDKVSVIAQCRGDVDLQTCRDCIKNATRLILELCPQKK
SAFGIYDKCLIRYSNESFIGTVSTDPQKIYYYNQNFSNPQLFFNRYLTPVLENLRSRASE
GGKRKFAANITNAPDFARIYVLVQCTADLSADDCFNCLTTGYQTLPSCECYAKRGNYYLM
PSCIIRYEPYSFFNESFAEAPPSPPPASLPLPPPASPPLPQPGKDDKTARTVIIIVVPTV
TVVIFVVCIPVILMKRRKRKLVNKRESIHVDDISTAESLQYDFSTIRAATNNFSDVNKLG
QGGFGPVYKGKLPNGQEVAVKRLSADSGQGDLEFKNEVLLVARLQHRNLVRLLGFCLDGI
ERLLVYEFVPNASLDHFLFDSVKRRQLDWERRSRIIGGIARGILYLHEDSRLRIIHRDLK
ASNVLLDAEMNPKISDFGMARLFTLDETQGSTSRIVGTYGYMAPEYAMHGQFSVKSDVFS
FGVLVLEILSGQRNTSFRNGESVEDLLSYAWSNWREGTTTNFIDPMLRGSTGLVRDIVRC
IHIALLCVQENVANRPTMAAVVLMLSSLSLSLPVPSGPAYYMHNDISPETSLVQEYNSRM
SDSREPAKSKSISSSRNEASITELYPRLVILIFQFYFFFELSIAQPSFRSYACADYTDKT
EFSPNSAYDTNLNTLLSTLSRDMDSYGFYNTSIGQNPDKVSVVAQCRGDVESQTCRNCIT
NATLKILEVCPYKKAGFGYYDDCTLRYSNESIIGTVSNNPLVFIFNTANVSSPDVFMQED
LRTLLESLQSKASAGGKRKFARNSTRGPDFQTIHALVQCTADLSAEECFNCLRTGYESLP
SCPCYGKRAATVLMPSCNFIFQVNPFSNKLPTEAPPPLWPPPPSPLWQSPPPLPPSPPPT
VTARTVIITVVPTVTVVILIVCTFVILRKRQKRKHLLNPIESIHGDDTTTAESLQYDFSA
IQAATDNFSNANKLGQGGFGPVYKGKLPNGQEVAVKRLSVGSGQGDLEFKNEVLLVARLQ
HRNLVRLRGFCLDGTERLLVYEFVPNASLDHFLFDSVKRRQLDWEKRYKIIGGIAKGILY
LHEDSRLRIIHRDLKASNVLLDADMNPKISDFGMARLFTLDETQGNTRRIVGTYGYMAPE
YAMHGQFSVKSDVFSFGVLVLEILSGQRNTRFRNGESVEDLLSYAWTNWREGTSSNLIDP
ILRGSSGIVRDITRCIHIALLCVQQNAADRPTMAAVVLMLSSLSLSLPVPSGPAYSMHNV
GNPENSLIQEYNSRMSRSSQNEVSITELYPR
NT seq 4056 nt NT seq  +upstreamnt  +downstreamnt
atgtggatgggaaagacagatatgagtttcttgacatggctggggatcattctaatattc
cacttttactaccttttctacctcagcatagcacagcctaatttcgcttttcaatcgcca
tgtgaaggtaatgagacagagtactctccgaatggtgcatatggcacaaaccttaacaca
gtcctctcctctctttcacgtaacatagatagtgatgggttttataatacttccataggc
caagatccagacaaggttagtgtcatcgcgcagtgtagaggagatgtcgatttacaaaca
tgccgtgactgtataaaaaatgcaactcgcttgattttagagctatgtcctcaaaagaaa
tccgcctttggtatttatgataagtgtctgataagatattcgaatgagtccttcataggc
acagtctcaacagacccacagaaaatttattattacaaccaaaatttctcgaacccgcaa
ttgttctttaaccgatatttgacacccgtgttggaaaatttacgaagtcgagcttcagag
ggtgggaagcgtaagtttgctgctaatattactaatgcccctgattttgcgaggatatat
gtacttgtacagtgcacagccgatttatccgctgacgattgcttcaattgtttgaccact
ggctatcaaactctacctagttgtgagtgttatgcaaagcggggaaactactatttgatg
cccagctgcattattcggtatgaaccttactctttcttcaacgagtcatttgctgaagct
ccgccatcgccaccacctgcctcgttgccactgccaccaccagcttcaccgccactgcca
caaccagggaaggatgataaaaccgcacgaactgtcatcattattgttgtgcccactgtc
acagttgttatttttgttgtttgtattcctgtcatcttgatgaagagacgaaagaggaag
ctggtgaacaaaagagagagtatacatgtggatgatattagtactgcagaatccctgcaa
tatgatttttctacaattagagcagcaacaaataacttctcagatgttaataagttggga
caaggcggatttggtcctgtgtacaagggtaagcttccaaatggacaagaagtagcagtg
aaaagattgtctgcagactcaggccaaggtgatctagaattcaaaaacgaggtcttgttg
gtcgccaggcttcaacacaggaatttggttaggttgttgggattttgccttgatggaata
gagagacttcttgtctacgaatttgttcccaatgcaagccttgaccactttttatttgat
tcggttaaacgtaggcaattggattgggaaaggcgatccagaatcataggaggcattgct
aggggaattctttatcttcatgaggattccagacttcgaatcattcatcgtgatctcaaa
gctagtaatgttctactagatgctgaaatgaatcctaaaatctcagactttggcatggca
aggctatttacactggatgaaactcaaggcagcacaagcagaattgttgggacctatgga
tatatggcaccagaatatgcgatgcacggacaattctcagtcaaatcagatgttttcagc
tttggagtactagtcctagaaattttaagtggccaaagaaacacttcttttagaaatgga
gaatccgtggaagaccttttgagctatgcttggtcgaactggcgcgaaggaacaactaca
aattttatagacccaatgctgaggggaagcacaggactagttcgtgacatagtgagatgt
atccacattgctttattgtgcgttcaagaaaatgtggcaaatagaccaactatggctgca
gtagttctcatgctcagtagcctctctttgagtcttccagttccttcagggcctgcatat
tatatgcacaacgatattagcccagagacttcccttgttcaagaatacaattcaagaatg
tcagattctagagaaccagccaaaagtaaatccatttcttcatcacggaatgaggcgtcg
ataactgagttatatcctcgtctggttattctaatattccagttttacttctttttcgag
ctcagcatagcacagcctagtttcagatcttatgcatgtgcagattacactgataagaca
gagttctccccaaatagtgcatacgacactaaccttaacacactcctgtccactctttca
cgggatatggatagttatgggttctataacacttccataggccaaaaccctgacaaggtt
agtgtcgtcgcgcaatgcagaggagatgtggaatcacaaacatgccgaaattgtataact
aatgctactcttaagattttagaggtatgtccttacaagaaagcgggctttggttattat
gatgactgtacgctacgatattcaaatgagtccatcataggcaccgtgtcaaataaccct
ttggtttttatatttaacacggcaaatgtctcgagccccgacgtgtttatgcaagaagat
ctaagaaccttgttggaaagtttacaaagtaaagcttcagcaggaggtaaacgcaagttt
gctagaaatagtactcgtggacctgattttcagactatacatgcacttgtacagtgtact
gcggatttatcagccgaagaatgcttcaactgtttaagaactggttatgaaagtttacct
agctgtccatgttatggaaagcgggctgctaccgttttgatgcccagctgcaattttata
tttcaagtaaaccctttttccaacaagctaccaactgaagctccaccacccttatggcca
ccgccaccgtcacccttatggcaatcgccaccgccactgccaccatctccaccaccaaca
gtaactgctcgaactgtcatcattactgttgtgcccactgtcacggttgttattcttatt
gtttgtacttttgtcatcttgaggaagaggcaaaagaggaagcacctgctgaacccaatt
gagagcatacatggggatgatactactactgcagaatccttgcaatatgatttttctgca
attcaagcagcaacagataacttctcaaatgcaaataagttgggacaaggcggatttggt
cctgtgtacaagggtaagcttccaaatggacaagaagtagcggtaaaaagattgtcagta
ggttcaggccaaggtgatctagaattcaaaaacgaggtgctgctggttgccaggcttcaa
cacaggaatttggttaggctgcgaggattttgtctagatggaacagagagacttcttgtc
tatgaatttgttcctaatgcaagccttgaccattttttatttgattcggttaaacgtagg
caactggattgggaaaagcgatacaaaatcataggaggcattgctaagggaattctttat
cttcatgaggattctagacttcgtatcattcatcgtgatctcaaagctagtaacgttcta
ctagatgcagatatgaatcctaaaatctcagactttggcatggcaaggctattcacattg
gatgaaactcaaggcaacacaagaagaatcgttgggacctatggatatatggcaccagag
tacgcaatgcacggacaattttcagtcaaatcagatgtttttagctttggagtactagtc
ctagaaattttaagtggccaaagaaacactcgtttcagaaatggagaatctgtggaagac
cttctgagctatgcttggacaaactggcgtgaaggaacatcttcaaatttgatagacccc
atattgaggggaagctcaggaatagttcgtgatataacgagatgcatccacatagcttta
ttgtgtgttcaacaaaatgctgcagatagaccaactatggctgcagtagttctcatgctc
agtagcctctctctgagccttccagtgccttcagggcctgcatactctatgcacaatgtt
ggtaacccggagaattcacttattcaagaatacaattcaagaatgtcccgttcatcacaa
aatgaggtgtcgataactgagttatatccaagataa

DBGET integrated database retrieval system