KEGG   Nicotiana sylvestris: 104219464Help
Entry
104219464         CDS       T05026                                 

Definition
(RefSeq) UDP-glucuronate 4-epimerase 6-like
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00520  Amino sugar and nucleotide sugar metabolism
nsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    104219464
Enzymes [BR:nsy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     104219464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 adh_short Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 104219464
NCBI-ProteinID: XP_009768456
UniProt: A0A1U7VU31
Position
Unknown
AA seq 450 aa AA seqDB search
MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPLAS
DNPNSHNNIHTTTHNLISSAFYGGGASWEKQVRRSSTPSRPNGFSVLVTGAAGFVGSHSS
LALKKRGDGVLGLDNFNSYYDPSLKRARQNLLSKHQIFIVEGDLNDVELLRKLFDIVPFT
HVLHLAAQAGVRYAMQNPLSYVNSNIAGFVNLLEIAKSANPQPAIVWASSSSVYGLNTKV
PFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFT
KDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLRVY
NLGNTSPVSVRKLVVILENLLNIKAKKNVVKMPRNGDVPFTHANVSLALRDFGYKPTTDL
SIGLRKFVKWYVSYYGIQPRVKKENDHSDD
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgccacctgacactagcaaaaccacaaagctagagcggtacaatagctatatt
cgcaaagtcaatagtacaaaactcatagctgcatcgtccaaacttctatttcgtgtcact
ttattagtggcgctactacttattttctttttcactataaattaccctccgttagcttca
gataaccctaattcacacaacaacatccatactaccacccacaacctcatctcatccgcc
ttctacggaggcggagcatcgtgggagaaacaagtccgccgctcctccactcctagccgc
cctaacggcttctccgtcctcgtcaccggtgctgctggtttcgttgggtcccactcttct
ttagcattaaagaaacgtggcgacggtgttcttggccttgacaacttcaattcctactat
gatccttctttaaaacgggctcgccaaaatctcttatccaaacaccaaatattcatagtc
gagggtgacctaaacgacgtcgaacttcttcgtaaactcttcgacattgttccatttaca
catgtcctccatttagctgcacaagctggcgttcgttacgcgatgcaaaatcctctctct
tatgtcaactcaaatatagctggatttgttaatttattagaaatcgccaagtcagctaac
cctcaacccgcaatcgtctgggcatcgtccagttcggtttacgggttaaataccaaagta
cccttttcagaagagcacagaacggatcaacccgcaagtttatatgcagcaacaaaaaaa
gcaggtgaagaaattgctcatacgtataaccatatttacggtctttctttaaccgggtta
agattttttactgtttacggtccatggggtagacccgatatggcgtattttttctttact
aaggatatgatacaaggtaaatcaattaatgtttacgtaacacaagatgataaagaggtg
gcgcgtgatttcacgtacattgatgatatagtaaaagggtgtgttggggcgttggatacg
gcggagaagagcaccggcagcggcggaaagaagaaaggtccggcgcagttgagggtttat
aatttgggtaatacttcgcctgtgtcggtgaggaaattagtggttattcttgaaaatttg
ttgaatattaaggctaaaaagaatgttgttaaaatgccacgaaacggtgacgttccgttt
actcatgctaacgtgagccttgcgttaagggattttggttataagcctaccactgatttg
tctattgggttgaggaaattcgttaagtggtatgtgagttactatggaattcaaccaagg
gtaaaaaaggaaaatgaccattccgatgattaa

DBGET integrated database retrieval system