KEGG   Nicotiana sylvestris: 104223114Help
Entry
104223114         CDS       T05026                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK8-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
nsy  Nicotiana sylvestris
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nsy01001]
    104223114
   01009 Protein phosphatases and associated proteins [BR:nsy01009]
    104223114
Enzymes [BR:nsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104223114
Protein kinases [BR:nsy01001]
 Serine/threonine kinases: Other
  Wnk family
   104223114
Protein phosphatases and associated proteins [BR:nsy01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104223114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104223114
NCBI-ProteinID: XP_009772813
UniProt: A0A1U7W2H3
Position
Unknown
AA seq 311 aa AA seqDB search
MDYGLQKVEEKSPCGRFVRYSDVLGEGAFKEVYLGFDQVQNIEIAWNQISFHGEDGEALL
KTPEKLFSEAVLLQSLNHERVMKCLSYWFDSEAKTLNMITELFPSGSLTKYMLKSNNGTG
IDLGNIKNWGRQILEGLSFLHGQNPKIIHRDIKCDNIFVQSGGKQVKLGDFGLAIHLMEG
DFAKEVKGTPQFMAPELYDGEYNELVDIYAFGMCLLEMVTGEYPYRECNNQGQILRKVYI
TGEKPAFLGKVKDSRVKDIIEKCLLPMSVRPSAEELLEDPFFVYNGGSSTMEACAPTASF
VVSHPFRGIKC
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggattacgggttacagaaagttgaagagaaatctccatgtggtaggttcgttagatat
agtgacgtgttaggtgaaggcgcttttaaagaggtgtacctaggttttgatcaagttcag
aacattgaaattgcgtggaaccaaataagttttcatggagaagatggtgaagcattatta
aaaaccccagaaaagttgttctctgaggctgttctattgcaatctttaaaccatgagagg
gttatgaagtgcctctcttactggtttgattccgaggcaaaaactctaaacatgatcaca
gaattattcccttcgggcagtttgacaaagtatatgttgaagagtaataacgggactggt
attgacttggggaatattaagaactggggtaggcagattcttgaaggtttgagctttctt
catggacaaaacccaaagatcattcatagagacatcaagtgtgataatatttttgttcag
agtggtggcaaacaggttaagcttggagattttgggttggcgattcatcttatggagggt
gatttcgccaaagaggttaagggaacgcctcaattcatggctcctgagctctacgatggt
gaatacaatgaactggtggacatatatgcattcgggatgtgtctacttgagatggttacg
ggtgaatatccatatagggaatgcaacaatcaagggcaaatacttaggaaagtgtatatc
actggtgaaaaacctgcatttcttggaaaggtaaaagactccagagtgaaggatatcatt
gagaagtgtttgcttcccatgtctgttaggccgtccgcagaagagttgctggaagatcca
ttctttgtgtacaatggtggatcatcaacaatggaggcttgtgctcctactgccagtttt
gtagttagtcatcctttcaggggaataaagtgttag

DBGET integrated database retrieval system