KEGG   Nicotiana sylvestris: 104228095Help
Entry
104228095         CDS       T05026                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
nsy  Nicotiana sylvestris
Pathway
nsy03040  Spliceosome
nsy04141  Protein processing in endoplasmic reticulum
nsy04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104228095
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104228095
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104228095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nsy01009]
    104228095
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nsy03041]
    104228095
   03009 Ribosome biogenesis [BR:nsy03009]
    104228095
   03110 Chaperones and folding catalysts [BR:nsy03110]
    104228095
   04131 Membrane trafficking [BR:nsy04131]
    104228095
   03051 Proteasome [BR:nsy03051]
    104228095
   03029 Mitochondrial biogenesis [BR:nsy03029]
    104228095
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nsy04147]
    104228095
Protein phosphatases and associated proteins [BR:nsy01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104228095
Spliceosome [BR:nsy03041]
 Complex B
  Other components
   Prp19 complex
    104228095
 Complex C
   Prp19-CDC5 complex
    104228095
Ribosome biogenesis [BR:nsy03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    104228095
Chaperones and folding catalysts [BR:nsy03110]
 Heat shock proteins
  HSP70 / DNAK
   104228095
Membrane trafficking [BR:nsy04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    104228095
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104228095
Proteasome [BR:nsy03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104228095
Mitochondrial biogenesis [BR:nsy03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    104228095
Exosome [BR:nsy04147]
 Exosomal proteins
  Proteins found in most exosomes
   104228095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 104228095
NCBI-ProteinID: XP_009778799
UniProt: A0A1U7WVU0
Position
Unknown
AA seq 650 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPTNTVFDAKRLIGRRFNDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA
EEISSMVLVKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGTISGLNVMRIINEP
TAAAIAYGLDKKAGSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD
NRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSGVHDIVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPSPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKK
KVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDQAISWLDANQLAEADEFED
KMKELESICNPIIAKMYQDGGAGPDMAGGMDEDGPSAGASGAGPKIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaaaggcgaaggaccggcgatcggaattgatttagggacgacgtactcgtgt
gttggtgtatggcagcatgatcgtgttgagatcatagcgaatgatcaagggaacagaacg
acgccgtcttatgttgcttttactgatacggaacggttgattggggatgctgctaagaat
caagttgccatgaatcctactaacactgtctttgatgccaagcgactgattggtaggaga
tttaatgacccctcagtacaaagtgacatgaaactgtggccttttaaggtcattcccggc
cctgcggacaagcccatgattgttgtcaattacaaaggcgaagagaagcaattttctgct
gaagaaatctcctctatggtccttgttaagatgaaggagattgcagaggcctttcttgga
acaacaataaagaatgctgttgttactgtgcctgcctacttcaatgactcgcaacgtcag
gctactaaggatgctggaactatttctggcctcaacgttatgcgtattatcaatgagcct
actgctgctgcgattgcttacggacttgacaagaaagcaggcagttcaggggagaagaat
gtgcttatttttgacttaggtggtggtacatttgatgtctcacttcttactattgaagaa
gggatttttgaagtgaagtctactgctggtgatacgcatcttggtggggaggattttgat
aataggatggttaatcactttgtccaggaattcaagaggaagcacaaaaaggatatcagt
ggaaatcctagagctcttaggaggctaagaactgcttgtgaaagggctaaaagaacactc
tcatccactgctcagactactattgaaattgattctctttatgagggtattgatttctat
acgactattactcgtgctcggtttgaggagcttaacatggatcttttcagaaaatgtatg
gagcctgtcgaaaagtgtttgagggatgccaaaatggataagagcggtgttcatgacatt
gttcttgttggtggctcgactaggattccgaaggtgcaacagttgctgcaggacttcttt
aacgggaaggaactttgcaagagtatcaaccccgacgaagctgtcgcctatggtgctgct
gtgcaagctgctatcttgagtggtgaaggaaatgaaaaagttcaggacctgttgctgttg
gatgtcactccgctttcacttggtcttgagactgctggaggtgttatgaccgtcttgatt
ccgaggaataccacaattccaactaagaaagagcaagtgttttctacctattcggataac
cagcccggagtcttgattcaggtgtacgagggtgagagggcaagaactcgagacaacaac
ttgttgggtaaatttgaactctccggtatacctccttctcctaggggtgtgcctcagatc
acagtctgctttgatattgacgcgaatggtatcttgaacgtctctgctgaggataaaacc
accggacagaagaacaagattacaattacgaatgataagggtaggttatcaaaggaagaa
atcgagaagatggtgcaagaagcagagaagtacaaggcagaggatgaggaacacaagaag
aaggtagaggcgaaaaatgcgttggagaactatgcctacaacatgaggaacactatcaag
gatgagaagattggttctaagctaagcccagatgacaagaagaagattgaggatgctatt
gatcaggcgatctcgtggctcgacgccaaccagctggcggaggccgatgaattcgaagat
aagatgaaggagcttgagagcatatgtaaccccattattgcaaagatgtaccaggatgga
ggtgctggtcctgatatggctgggggcatggatgaagatggtccttctgctggtgcaagt
ggtgcaggtcctaagattgaggaagttgattaa

DBGET integrated database retrieval system