KEGG   Nicotiana sylvestris: 104231790Help
Entry
104231790         CDS       T05026                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00520  Amino sugar and nucleotide sugar metabolism
nsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    104231790
Enzymes [BR:nsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     104231790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-GeneID: 104231790
NCBI-ProteinID: XP_009783145
UniProt: A0A1U7X9M0
Position
Unknown
AA seq 433 aa AA seqDB search
MKLHKQSSRRDEEIPNSQISLPYSPKTLKHPTRSLPRSINYLLKEQRLLFILIGILIGST
FFIFQPSLSLLSTSSEPHSSIPRSYNALNHESLSTISSYNNVPIFKGRVPVGVGRKRMRI
VVTGGAGFVGSHLVDKLIKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILL
EVDQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRIGARFLLTSTSEVYGDPLE
HPQKETYWGHVNPIGVRSCYDEGKRTAETLTMDYHRGAGVEVRIARIFNTYGPRMCLDDG
RVVSNFVAQAIRNQPMTVYGDGKQTRSFQYVSDLVDGLVALMEGEHIGPFNLGNPGEFTM
LELAEVVKEVIDPSAKIEFRANTADDPHKRKPDISKAKELLNWEPKVPLREGLPLMVNDF
RNRILNEDEGKEN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcataagcagtctagcagaagagatgaagaaatacccaattctcaaataagc
ttaccatactcaccaaagaccctcaaacatccaactagatctctacccagatccattaac
tatctcctcaaagaacaaagacttttattcattcttattggtattctcattggttccact
ttctttatatttcaacctagtctttctctcttaagcacatcttctgaaccacattcttca
attcccagatcatataatgctttaaatcatgaatccttatcaactatttcatcttataat
aatgtaccaatttttaaagggagggtaccagttggggttgggagaaaaaggatgaggatt
gtagtaactggtggggctggttttgttgggagtcatttagtggataagttaattaagaga
ggtgatgatgttattgttattgataatttctttactgggaggaaagaaaatgtgatgcat
cattttgggaatccaagatttgagcttattaggcatgatgttgttgagcctattttgttg
gaagtagatcagatttatcacttggcttgccctgcttctcctgttcactacaagtataat
cctgtcaaaactattaagacaaatgtgatgggcacgcttaacatgttgggccttgcgaag
aggattggtgcgaggttcttgcttaccagtacaagtgaggtttatggtgacccactcgag
catcctcaaaaggaaacatattggggtcatgtgaatccaataggtgttaggagctgctat
gacgagggaaaacggactgctgaaacattgactatggattaccatcgtggtgcaggtgta
gaggtgcgtattgctcggattttcaatacatatggacctcgcatgtgtctagatgatgga
cgtgttgtcagcaactttgttgcccaggccattcgcaaccaaccgatgacagtatatggt
gatggaaagcaaacacgaagcttccaatatgtctctgatctggttgatggattggtggcc
ctcatggagggtgagcatatcggccctttcaacttaggaaatccgggagaattcaccatg
ttggagcttgctgaggtggttaaagaagtgattgatcccagtgcaaaaatcgagttcaga
gccaacacggccgatgatcctcacaagaggaaaccagatattagcaaagctaaagagctg
ctaaactgggaaccaaaagtacccttgcgagaagggcttcctctcatggtcaatgatttc
cgcaatcgcatattgaatgaagatgaaggaaaagagaattaa

DBGET integrated database retrieval system