KEGG   Nicotiana sylvestris: 104232006Help
Entry
104232006         CDS       T05026                                 

Definition
(RefSeq) probable 9-cis-epoxycarotenoid dioxygenase NCED5, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00906  Carotenoid biosynthesis
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
Module
nsy_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    104232006
Enzymes [BR:nsy01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     104232006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 104232006
NCBI-ProteinID: XP_009783401
UniProt: A0A1U7X156
Position
Unknown
AA seq 599 aa AA seqDB search
MASTPANFYTWAKVQVPHPFSSSNSSTCSPVDLGFPSKSISMRKPTPRAKIQCALHSPAV
LTFPKQPYQYPTITKRDTPSPPQPAWNLFQKAAAKALDIMESALISRDKQKPLPKTSDPG
VQIAGNFFPVPEMPVRHNLPITGTVPDCINGVYVRNGANPHFEPVAGHHLFDGDGMLHAV
TINGGSVNYSCRFTETERLVQERGLGKSVFPKAIGELHGHSGIARLLLFYARGLCGLVDH
SHGTGVANAGLVYFNGRLLAMSEDDLPYHVAIKPCGDLQTKGRYDFDEQLKSTMIAHPKI
DPVSGELFALSYDVVQKPYLKYFKFSKNGKKSYDVEIPLDVPTMMHDFAITENYVVIPDQ
QVVFKLQNMIKGGSPVIYDEKKKSRFGILPKNVKDSNRIIWVESPDTFCFHLWNAWEEPE
NDEVVVIGSCMTPPDSIFNECDENLKSVLSEIRLNLKTAESRKRAIISSTEQVNLEAGMV
NKNKLGRKTQYAYLAIAEPWPRVSGLAKVDLSTGEVQKYMYGDTRYGGEPLFLPRNQCTE
KEDDGYILAFVHDEKIWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFVSKKDLENQV
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggcttctacacctgcaaatttttatacatgggctaaagtccaagtccctcatcccttt
tcatcgtctaattcctctacttgttcacctgttgatttgggctttccttcaaaatccatc
tccatgagaaagcccactcctcgagctaaaattcaatgtgctctccactcccctgctgtt
ctcacttttccaaaacaaccctatcaatatccaacaattaccaaaagggacaccccttct
cccccgcaacctgcctggaatctctttcagaaagccgctgcaaaagcattggacataatg
gagagcgcgttgatctcacgcgataagcagaaaccgctcccaaaaacctccgatcctggc
gttcaaatagccggaaatttttttccggtgccggaaatgcctgtccggcataaccttccc
attaccggaactgtacccgattgcattaacggcgtttacgtacgtaatggcgctaacccg
cattttgaacccgttgccggtcaccatttattcgacggtgacggcatgcttcatgcagtc
accattaacggcggttcagtgaactattcgtgccggttcactgaaaccgaaagactagtt
caagagcgtggattgggtaaatcggttttcccgaaagccattggtgaactccacgggcat
tctggtattgcgcgtcttctcctcttctatgcgcgtggactttgtggactcgtagatcat
agtcatggaacaggcgtggctaacgccggtttagtttactttaacggcaggttattagcc
atgtcagaagatgatcttccttatcacgttgctattaagccttgcggcgatttacaaaca
aaggggagatacgattttgacgagcaactcaaaagcacaatgatagctcatccgaaaatc
gatccggtttctggcgagctattcgctttgagttacgatgttgttcagaagccgtacttg
aaatatttcaagttttccaaaaatgggaagaaatcgtatgacgttgagatcccactggac
gttccaacaatgatgcatgattttgctattactgaaaattacgttgtgatccctgaccag
caagtggttttcaagcttcagaatatgatcaaaggtggctcaccagtaatctatgacgag
aagaagaaatctaggttcgggattttacccaaaaatgttaaagattcaaatagaattatt
tgggtcgagtcaccagacacattctgttttcatctttggaatgcatgggaggaaccagag
aatgacgaagttgtagttattggctcgtgcatgactccacctgactcaattttcaatgaa
tgtgatgaaaatctgaagagtgtactgtcagaaatcaggttaaatctgaaaactgctgag
tccagaaaacgggcaataatttcatcaacggaacaggtgaatcttgaagctggaatggta
aataaaaacaaacttggccgtaaaacacagtatgcttatcttgcaattgcagagccatgg
ccaagagtttcaggattagcaaaagtagacctgtcaactggggaagttcaaaaatacatg
tacggagatacaagatatggaggagagccactatttttaccgagaaatcaatgcacagaa
aaggaagatgatggatatattcttgcatttgtgcacgatgaaaaaatatggaagtcagag
ctgcaaatagtgaatgccatgactcttgagttggaggccactgtcaagcttccttcaaga
gttccatatggtttccatgggactttcgtaagtaaaaaggacttggaaaatcaagtatag

DBGET integrated database retrieval system