KEGG   Nicotiana sylvestris: 104232031Help
Entry
104232031         CDS       T05026                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 3, peroxisomal isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00071  Fatty acid degradation
nsy00410  beta-Alanine metabolism
nsy00592  alpha-Linolenic acid metabolism
nsy00640  Propanoate metabolism
nsy01040  Biosynthesis of unsaturated fatty acids
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
nsy01200  Carbon metabolism
nsy01212  Fatty acid metabolism
nsy04146  Peroxisome
Module
nsy_M00087  beta-Oxidation
nsy_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    104232031
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104232031
   00592 alpha-Linolenic acid metabolism
    104232031
   01040 Biosynthesis of unsaturated fatty acids
    104232031
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104232031
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104232031
Enzymes [BR:nsy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     104232031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 104232031
NCBI-ProteinID: XP_009783428
UniProt: A0A1U7WXU4
Position
Unknown
AA seq 691 aa AA seqDB search
MKNSHFSSSSPYSSSMEKANFRTKVLSRHLNQENPTPINSILQSFPCLSYIPPEFSGPSS
VFDTKEMRKLLDDHNLEDKDWLFGLMLKNNLFNPKIRGGKVFVCPDYNQSKEQQREITMR
RIEYLLEHGVFKGWLTGNGPEDELRKLAFTDVVSIFDHSLSVKIGVHFFLWGGAIKFFGT
QRHHDKWLRDTENYVVKGCFAMTELGHGSNVRGIETVTTYDSSTREFVINTPCESAQKYW
IGGAANHATHTVVFSQLHIDGKNQGVHAFIAQIRDENGNICPNIRIADCGHKIGLNGVDN
GRIWFDNVRVPRENLLNSVADVSPNGKYLTAIKDPDQRFAAFMAPLTSGRVTIAVSATYS
AKIGLATALRYSLTRRAFSVTPNGPEVLILDYPSHQRRLLPLLAKTYAMSFASNYLKKIY
VKRTPEMNKVIHVISSAFKATASWHNMRTLQECREACGGQGLKTENRVGQLKGEFDVQST
FEGDNNVLMQQVSKALLGEYVTAKRSKKPFKGLGLEHMNNSRPVVPSQLKSSAMRQSQFQ
NDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTLNYQLAEDLGRAFSDRAVLHTFLEAE
ATVTSGPLKDILGLVRSMYVLVTLEEDVAFLRYGYLSTDNAAVVRKEVANLCSELRPHAL
SLVSSFGIPDAFLGPIAFNWVEVNVWSSEQN
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcccatttttcttcatcatcaccttattcttcttcaatggaaaaagcgaat
ttcagaacaaaagtccttagcagacacctaaatcaagaaaatccaacacccataaattca
atactccaatctttcccatgtctcagttacatcccacctgaattttcaggaccatcttct
gtttttgacacaaaagaaatgagaaaacttttagatgatcataatttagaggacaaagac
tggctttttggtttaatgttaaaaaacaatctttttaatccaaaaataaggggtggcaaa
gtttttgtttgccctgactataaccagtctaaagaacagcaaagggaaattactatgagg
agaattgagtatcttcttgaacatggtgtttttaaaggttggctcactggtaatggaccg
gaagatgagttgaggaaacttgcttttactgatgttgttagcatctttgatcattctctt
tctgtcaaaatcggcgtccattttttcttatggggcggtgcaatcaagttttttggtacc
caacgacatcatgataagtggttgagggacacagagaattatgtggttaagggttgcttt
gctatgacagagttgggacatggaagtaatgttcgaggtattgaaacagtcacaacctat
gattcaagcaccagagagtttgtcataaacactccgtgtgaatcagctcagaagtattgg
attggcggtgcagctaatcatgcaacacatacagtagttttctctcagctccacattgac
gggaaaaatcaaggtgtccatgcttttattgcccagatcagagatgaaaatggcaacatt
tgtccaaacatccgtatagctgattgtggtcacaagattggcttgaatggggttgacaat
ggtagaatctggtttgacaatgtccgggtacccagagaaaatttgttaaattcagtggcg
gatgtttctccaaacgggaaatatcttactgctattaaggaccctgaccagcgatttgca
gcatttatggcccctttgacatctggtcgtgtgacaatcgcagttagtgcaacttactca
gcaaagattggtttggcgactgcattaagatactcgctgacaaggagagcattttcagtt
actcctaatggaccagaagttcttatactcgattatccaagtcatcaacgacgacttctt
cctcttcttgcaaaaacatatgctatgagctttgcttctaactacttgaaaaagatttac
gtcaagaggacacctgagatgaacaaagttattcatgttatttcaagtgcattcaaagct
acagcaagttggcataacatgcgaactcttcaggaatgtcgtgaagcttgtggaggccaa
gggttgaagactgaaaatcgggttggccagctgaaaggtgaatttgatgtgcagtctact
tttgagggtgacaacaatgttcttatgcaacaggttagcaaggcacttcttggggaatat
gtgacagccaaaaggagtaagaagccgttcaaaggattgggattagaacacatgaacaac
tctcgtcccgtcgtaccttcacaactcaaaagttccgcaatgaggcaatcccaattccag
aacgacatattctgcctacgagaacgagacctgttggaacgttttgctgctgaagtttca
ttatgccagtcacaggggaaaagcaaagaatatgcatttactttgaattatcagctcgct
gaagaccttgggagagccttctcagaccgagcagttctgcatactttcctcgaggcagag
gcaaccgtcacgtctggcccacttaaggatattttggggcttgtgagatcgatgtatgtt
ttggtcaccctagaggaggatgttgcattcctccgatacggatacttgtcaacggacaat
gctgctgtggtgagaaaagaagttgcaaatctctgcagtgaactaaggccacatgcactt
tccttggtcagttctttcggcatacccgatgctttcttgggccctatagctttcaattgg
gttgaagtcaatgtttggtcttctgaacaaaactag

DBGET integrated database retrieval system