KEGG   Nicotiana sylvestris: 104233433Help
Entry
104233433         CDS       T05026                                 

Definition
(RefSeq) germacrene C synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    104233433
Enzymes [BR:nsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     104233433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth AbiJ_NTD5
Motif
Other DBs
NCBI-GeneID: 104233433
NCBI-ProteinID: XP_009785132
UniProt: A0A1U7WYY7
Position
Unknown
AA seq 499 aa AA seqDB search
MLVETPDNSIQKLELIDTIQRLGVSYHFKNEIQTSIKNIFDASQQSENEDDNLYVVALRF
RLLRQQRHFMSSDVFKKFTNKDGKFMETLTKDVQGLLSLYEAAHLRVHEEDILEQALSFT
LTNLESMGPKLSNSSLKTQVSAALSQPIHTNLPRMTARKYISIYENIEPQNNLDLLFKFA
KLDFNIVQKVHQRELGELTRWWKDLIEQFPYARDRLVECHFYTVGIYFEPQYSRARELMT
KVLTIYTIIDDTYDAFATYDELVPFTDAIDRYGCDISAMGSIPPSLKPTYQALVDLDTQI
EEKLIREGTLDRLYYAKLEMKKVARAYFKEAEWLNVGYIPKCDEYMKNANISTTCMMSAT
ISLAIMEEHITKETFEWMINEPLILQASSAINRLKGDCIGHNLERHRKHIASFIECYMKE
FGGSKQDAYAEAQKKITNAWKDMNKDFLCSTHDEVPTFALELVINIARVAYIFEENDFAS
AQGEFKDKINLLFVEPVNV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctagttgaaacacctgataatagtatacaaaaacttgaattgattgatacaatccaa
cgattgggagtttcatatcattttaaaaatgagattcaaacatccattaagaacatcttt
gatgcgtcccaacagagtgaaaatgaagatgacaacctttatgttgtcgctcttcgtttt
cgactactgagacaacaaaggcatttcatgtcttctgatgtgttcaagaaattcaccaac
aaagatggaaagttcatggaaacactgaccaaagatgtacaaggattattaagtttatat
gaagcagcacatttaagagtacacgaggaagatattcttgaacaagctctgagttttaca
ctcactaatttggagtcaatgggccctaaattgagcaattcatcacttaagacccaagtc
agtgcagccctaagtcagcccattcatacaaatctaccaaggatgacagcaagaaaatac
atatctatttatgagaacattgaacctcaaaataatttggatttgctttttaaatttgca
aaattagattttaacattgtgcaaaaggtgcatcaaagagagcttggcgagcttacaagg
tggtggaaagatcttatagagcaatttccatatgcaagagatagattggtggaatgtcac
ttttataccgtaggaatctactttgagcctcaatatagtcgtgcaagagaattgatgaca
aaagtactcaccatatacaccattattgatgacacttacgatgcttttgcaacttatgat
gaacttgtaccttttaccgatgcaatcgatagatacggatgtgacattagtgccatgggt
tcaataccgcccagtctgaaacctacttatcaagcccttgtagaccttgatactcaaata
gaagaaaaacttatcagagaaggtacattggatcgtctctactatgcaaaacttgagatg
aaaaaagtagctagagcgtatttcaaggaagcagaatggttaaatgttggctatattcca
aaatgtgacgagtatatgaagaatgcaaatataagtactacttgtatgatgagtgcaaca
atttccttggctattatggaggaacatataaccaaagagacttttgaatggatgataaat
gagcctttgattcttcaagcttcatcagcaatcaacagattaaagggagattgtattgga
cataatttggaacgccatagaaagcatatagcttcattcatagaatgctacatgaaagaa
tttggaggttcaaagcaagatgcatatgctgaggctcagaaaaaaattactaatgcatgg
aaagacatgaacaaggactttctttgttctactcatgatgaagtaccaacgtttgctctt
gaattggttataaatatagcacgcgtggcatatattttcgaagaaaatgattttgcaagt
gcccaaggcgaatttaaagacaagattaacctgttgtttgttgagcctgtcaatgtttga

DBGET integrated database retrieval system