KEGG   Nicotiana sylvestris: 104233747Help
Entry
104233747         CDS       T05026                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00071  Fatty acid degradation
nsy00592  alpha-Linolenic acid metabolism
nsy01040  Biosynthesis of unsaturated fatty acids
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
nsy01212  Fatty acid metabolism
nsy04146  Peroxisome
Module
nsy_M00087  beta-Oxidation
nsy_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104233747
   00592 alpha-Linolenic acid metabolism
    104233747
   01040 Biosynthesis of unsaturated fatty acids
    104233747
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104233747
Enzymes [BR:nsy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     104233747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 104233747
NCBI-ProteinID: XP_009785488
UniProt: A0A1U7X3Q7
Position
Unknown
AA seq 664 aa AA seqDB search
MEGVDYLADERRKAEFDVNEMKIVWAGSRHNFGLADRISKLVANDPGFSKEGRTMLPRKE
LFKNTLRKAAYAWKRIIELRLSEEEAAKLRHFVDEPAFTDLHWGMFIPAIKGQGTDEQQK
KWLPLAYKMQIIGCYAQTELGHGSNVQGLETTATFDPQTDEFVIHSPTLTSSKWWPGGLG
KVSTHAVVYARLITNGKDYGINGFIVQLRSLEDHKPLPGVTVGDIGMKFGNGAYNTMDNG
VLRFDHVRIPRDQMLMRVSQVTREGKYVQSDVPRQLLYGTMVYVRQTIVADASSALSRAV
CIATRYSAVRRQFGSQNGGQEIQVIDYKTQQSRLFPLLASAYAFRFVGEWLKWLYTDVTQ
RLQANDFSTLPEAHACTAGLKSLTTTATADGIEECRKLCGGHGYLCSSGLPELFAVYVPA
CTYEGDNTVLLLQVARFLMKTVSQLGSGKKPVGTISYMGRIEHLMQCRSDVKQAKDWLKP
SVVVEAFEARAARMSVACAQNLSKFDNPEEGFAELAADLAEAAVAHCQLIVVSKFIEKLQ
QDIPGKGVKQQLEVLCGIYSLFLLHKHQGDFLGTGYITSKQASLANDQLRALYSQLRPNA
ISLVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNQSDIADGFHEYIRPLLKQQLH
TARL
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggagggtgttgattatttggctgatgagaggagaaaagctgagtttgatgtgaatgag
atgaagattgtttgggctggttctcgccataattttggattagcagatcgtatctccaag
cttgttgctaatgatcctggcttcagtaaggaaggcaggactatgcttcctaggaaagag
ctatttaagaacacgctaaggaaggcggcatatgcatggaaacggatcattgaacttcgt
ctttctgaagaagaagcagctaagttaaggcattttgtagatgagcctgcttttaccgat
cttcattggggaatgtttataccagccataaaagggcagggcacagatgaacagcagaaa
aagtggttgccgttggcctataagatgcaaataattgggtgctacgctcaaactgaactt
ggacatgggtccaatgtgcaaggccttgaaaccactgccacatttgatcctcaaacagat
gaatttgtcattcatagtcctacattgacgtcaagcaagtggtggcctggtggattgggt
aaagtctctacccatgctgttgtgtacgctcgtcttataacaaatggtaaagactatggg
attaatggttttattgtccaactacgaagcttggaggaccacaaacctcttccaggtgtt
actgttggagacattggaatgaaatttggaaacggggcatacaatactatggataatggg
gtattaagatttgatcatgtgcgcattccaagagatcaaatgctgatgagggtttcacaa
gttacaagggaaggaaaatatgtccaatctgatgttccccgacaactcctttatgggaca
atggtatatgttcgtcaaacaattgtagcagatgcttccagtgctttgtctcgggctgtg
tgtattgcaaccagatatagtgccgttcgtagacaatttggttctcagaatggtggacaa
gaaattcaggtgattgactataaaactcagcaaagcaggctcttccccttgttggcttct
gcatatgccttcagatttgttggggagtggctgaaatggttgtacactgatgtgacccaa
agactgcaagcaaatgatttctcaacattgcctgaggcgcacgcatgtacggcgggattg
aagtctttgacaaccactgccactgctgatggaattgaagaatgccgaaagttatgtgga
ggtcatggatatctatgtagcagtgggcttccagagttatttgccgtttatgtacctgcc
tgtacatacgaaggagataacactgtgcttctactacaggttgcaaggtttcttatgaag
accgtttcacagctgggctctggaaagaagccagtgggtaccatatcttatatgggaaga
attgaacatttgatgcaatgccgttctgatgtgaaacaagccaaggactggctgaaacct
agtgtggtagtggaagcgtttgaagcaagggctgccagaatgtctgttgcttgtgctcag
aatcttagcaagtttgataatccagaagaaggctttgcagaacttgcagctgatttagct
gaagcagcagttgctcattgtcaattaattgttgtctccaagtttattgagaaattgcaa
caagacattcccgggaaaggggttaagcaacagctggaagtgctttgcggtatctattcc
ctcttccttcttcacaaacatcaaggagattttctcgggactggctatatcacctcaaag
caggcatcacttgctaatgaccagctcagagccttatattcccagcttcgtccaaatgct
atatcgctggttgatgcatttaactataccgatcacttccttgattcaattcttggacgt
tatgatggaaacgtgtatccgaaactgtatgaggctgcatggaaggatcctctcaaccaa
tccgatatagccgatggcttccatgaatatattaggccactactcaagcagcaactgcat
actgctcgactgtga

DBGET integrated database retrieval system