KEGG   Nicotiana sylvestris: 104234158Help
Entry
104234158         CDS       T05026                                 

Definition
(RefSeq) bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic-like
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00740  Riboflavin metabolism
nsy00790  Folate biosynthesis
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
Module
nsy_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    104234158
   00790 Folate biosynthesis
    104234158
Enzymes [BR:nsy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     104234158
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     104234158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-GeneID: 104234158
NCBI-ProteinID: XP_009785972
UniProt: A0A1U7X1F0
Position
Unknown
AA seq 552 aa AA seqDB search
MASINISLSSTCLSSSEALKNFKVFNGLHSGDVYSVNGVSSESFIRLNARAHFNIKTDFK
IRSALLSGEGDARSQYRGDSSLFSSLFTGTETQPDAVAFGTLAADVVPTTNGFPLDNDEF
DLDRPTQGFSSVPEAIEDVRQGKMVLVVDDEDRENEGDLVMAASKATPEAMAFFVRHGTG
IVCVSMLEEDLERLQLPLMVNDKKNEEKLCTAFTVSVDAKHGTTTGVSAQDRATTVLALA
SGDSKPEDFNRPGHIFPLKYRPGGVLKRAGHTEASVDLAMLAGLDPVGVICEIVDEDGSM
ARLPKLRQFAKEHNLKVISVADLIRYRRKRDQLVEHASAARLPTMWGPFTAHCFRSIIDG
IEHIAMVKGDIGDGQDILVRVHSECLTGDIFGSARCDCGNQLALAMQQIEAAGKGVLVYL
RGHEGRGIGLGHKLRAYNLQDAGRDTVEANEELGLPVDSREYGIGAQMLRDLGVRTMKLM
TNNPAKYRGLKGYGLAISGRVPLLCPITKENKKYLETKRAKMGHVYGLDLIRPATSTSTT
NGKPNVENISTI
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggcttccatcaacatttctctctcttcaacatgtttatctagctccgaagcgttaaag
aacttcaaggtgttcaatggactgcactctggagatgtatattctgttaatggggtctct
tcagagtcattcatacggcttaatgctagagcacactttaacatcaagaccgattttaag
attagatctgcgttattatcgggtgaaggagatgcccgttctcaatacaggggtgacagt
tctctgttcagtagtctctttactggaactgagactcaacctgatgctgtagcctttgga
acgctagcagcagatgttgttcccacaacaaatggctttcctttagataatgatgaattc
gatttggatcggccgacacaaggtttctcatctgttcctgaggccatcgaagacgttcgc
caaggaaaaatggtgctagttgtagatgatgaagacagagaaaatgaaggggatttagta
atggctgcatccaaagctacaccagaagctatggctttttttgtgaggcacggaactggg
atagtttgtgtgagcatgttagaagaagacttggagaggttacaacttccgttgatggta
aacgataaaaagaatgaggagaaactttgtacagcatttacagtctcagtggatgcaaaa
catggaacaactacaggggtgtctgctcaagatagagcaacgacagtactggcacttgca
tctggagattcgaagcctgaggatttcaaccgaccaggtcatatttttcctttgaaatat
aggccaggtggggttctaaaaagagctggacatactgaagcatctgtggatcttgccatg
ttagctggcttagaccccgttggagtaatatgtgagatcgtggatgaagatggttccatg
gccagattgcctaagcttcgtcaatttgcaaaagaacataacttgaaggtcatatcagtt
gctgatttaatcagatataggaggaaaagagatcagttggtagagcatgcttctgctgca
agattacctactatgtggggtccattcactgcccattgcttcaggtcaataatagatgga
attgagcacattgctatggttaagggagatattggagacggccaagatattcttgtccgg
gtacactcggagtgcctcacaggagatatattcggttcagccagatgtgactgtgggaac
cagctggcacttgcaatgcaacaaattgaggctgctggcaagggggttttggtttacctc
cgtggtcatgagggtagaggaattggtttgggtcacaaacttcgtgcttataatttacaa
gatgctggacgtgatactgttgaagcgaatgaagagcttggtttgcctgttgattcaaga
gagtatgggattggtgcgcagatgttgagggatcttggtgttcgaactatgaagttgatg
acaaacaatcctgcaaaatatagagggcttaagggttatggtctggcaatttctggtagg
gtcccacttctgtgtcccattacaaaagaaaacaagaaatatctggaaacaaaacgtgct
aaaatgggccatgtgtatgggttggaccttattcgccctgcaaccagcaccagcacaaca
aatggtaaaccaaacgtggagaatatttctacgatatag

DBGET integrated database retrieval system