KEGG   Nicotiana sylvestris: 104234285Help
Entry
104234285         CDS       T05026                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like isoform X1
Organism
nsy  Nicotiana sylvestris
Pathway
nsy03040  Spliceosome
nsy04141  Protein processing in endoplasmic reticulum
nsy04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104234285
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104234285
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104234285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DIOX_N StbA
Motif
Other DBs
NCBI-GeneID: 104234285
NCBI-ProteinID: XP_009786120
UniProt: A0A1U7XI18
Position
Unknown
AA seq 917 aa AA seqDB search
MERDLEFVIDELMINSGNAVESVTETLNSISSEIKRLLQMLKDFGAKVLVTLKNVGGQVL
VTLKNVGGQVLLTLKNIGGEMVVTMKNIGGGFASWFNRVFPPETRTEKIKEWCKFALCFI
GILVILYVSFYVGKVGAEIMKNIFGNGFPSWFTTVFPPGTRVQMIKEWCQVALYIIKFLL
RSTEQDDESFRVGKMVATVKNFGDGFADVFPTPGTKLHKIKEWCQVASPFIGLLLRWLQE
DAETYYQGVKSQLELTNLEGESSMYAAVLGLILLLPNYLKEKNDKIKPVAAKAQGPVIGI
DLATTYSSVDVLPGPMIGIDLGTTYSSVGVWQHDHVEIIANGQGNRRTPSYVSFTDLERL
IGHVAEKEVARNPTNTVFAAKRLIGRRFSDASVQSDMKLWPFQVGAVAGDKPPRIGVYYK
GEKKQFTAEEISAMVLMKMKEIAEAFLGTSVRNAVVTVPAYFNDSQRQATKDAGVIAGLN
VMRIINEPTAAALAYYGLDNKATGVAEKNVLIFDLGGGTLDVSILTIVEGSLFVVKATAG
DTSLGGEDFTNRLVNHFVQEFKLKSTKDITSNPMALQRLRTACESAKRTLSSSAQTTIEI
VNLYEGIDLSSTITRTKFEELNMDLFAKCVTSVERCLRDARMIQISVHDVVLIGGSTKIP
KVQQLLQDLFNGKELCKSINPDEAVAYGAVVHAAILSGERKVQDLLPLDVTPLSLSVRSD
TSHNNAVTSIPKNTTIPTRNKHFTIYPHTKTIQVFEGEKVKITDNNLLGEFELSGVPPKS
PQITARLQIDANGILNVSTEDTTNGKKNKITVTNNKGRLSKEEIEKMVQEAEKYKSEDEE
HKRKVKAKNALENYSNNMKKAVKDYKETIEDATEQSNQWLNGNHLAGADQIEGKLKELQS
LCNSMTAKMYPGAGGDM
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggagagagacttggaatttgtaatagacgaattgatgatcaattcagggaacgcggtg
gaaagtgtaacggagacacttaactcaatatcaagtgagataaaaagattgttgcagatg
ctaaaggattttggtgccaaagtgttagtgacgctaaagaatgttggcggccaagtgtta
gtgacgctaaagaatgttggtggccaagtgttactgacgctgaagaatattggaggagaa
atggtggtgacaatgaagaatattggtggtggatttgctagttggtttaatagggtgttt
ccgccggaaactagaaccgaaaagatcaaagaatggtgtaagtttgctttatgcttcata
gggattctagttattctttatgtaagcttttatgttggaaaagtaggggcggaaataatg
aagaatatttttggtaatggatttcctagttggtttactacggtgtttccgccgggaact
agggttcaaatgatcaaagaatggtgtcaggttgctttatacatcataaagtttctgctg
cgttcgactgaacaagatgatgaaagctttcgtgttggaaaaatggtggcgacagtaaag
aattttggtgatggatttgctgacgtgtttccgacgccgggaactaaactccataagatc
aaagaatggtgtcaggttgcttcacctttcattggtttgctgctgcggtggcttcaagaa
gatgctgaaacctattatcagggagtgaaatcgcagctggagctgactaatttagagggt
gaaagctctatgtatgcggcggtgctgggactgatactgctactgcccaattatctgaag
gaaaaaaatgataaaataaagccagtggcagcaaaagcacaaggaccggtgatcggaatc
gatctcgccactacatactcatccgtcgacgtgttgccaggaccgatgatcggaatcgat
ctcggaactacatactcatccgtcggcgtgtggcaacacgaccatgttgaaatcattgcc
aatggtcaaggtaacagaaggacgccatcctacgttagtttcactgatttggagcgtctc
attggtcatgtcgccgaaaaagaagtcgctaggaaccctaccaatactgtctttgctgct
aaaaggttgataggtaggagatttagtgatgcctctgtgcagagtgacatgaagttgtgg
ccattccaggttggtgctgttgctggtgataagccgccgaggattggagtctactacaag
ggtgagaagaaacagtttactgctgaggagatctcagctatggtgctcatgaagatgaaa
gagattgctgaagctttccttggcacaagtgttaggaatgctgtggttactgttccagcc
tacttcaatgactctcagcgtcaggccaccaaggatgctggtgttattgcaggcctgaat
gtgatgcgtattatcaatgaacctacagcagctgcccttgcttattatggtcttgataac
aaagctacgggtgttgctgagaagaatgtgctaatctttgatcttggtggtggtacattg
gatgtctctattctcacaattgtggaaggtagtctctttgtggtgaaagctactgctgga
gacaccagccttggaggcgaggacttcaccaataggttggttaaccattttgttcaggaa
ttcaagctaaagagcacaaaggatatcactagtaatcctatggcgctccaaaggttgaga
actgcatgtgagagtgcaaaaaggaccctttcatcctctgctcagaccaccattgaaatc
gtcaatctatacgagggtattgacctttcttccaccatcacacgtactaagtttgaagag
cttaacatggatctgtttgcaaagtgtgtgacatcagttgagcgctgtttgagggacgct
cggatgatccagatctcggttcatgatgtcgtcctgattggtggttccactaaaatccca
aaggtccaacaacttttgcaggaccttttcaatggaaaggagctatgcaaaagcatcaac
cctgatgaggctgttgcttatggtgctgtagtgcatgctgcaattttaagtggtgagcgt
aaggtgcaggaccttttgccgttggatgttactcctctttcccttagtgtgagatctgat
acttctcataacaatgctgtaacgtcgattcccaaaaacaccactatcccaacaaggaat
aaacactttacaatctacccccacacgaaaacgattcaggtctttgaaggtgagaaagtg
aagatcacggacaacaacttgcttggcgaattcgagctctctggcgttcctcctaaaagt
cctcaaatcacagcgcgccttcaaattgatgccaatggtatcttgaatgtctctactgag
gacacgacgaatggtaagaagaacaagattacagtcaccaataacaagggcagactctcg
aaggaggagatcgagaagatggttcaggaagcagagaagtacaaatctgaggatgaggaa
cacaagaggaaggtcaaggcaaagaatgctttggagaactactcaaacaatatgaagaaa
gctgtgaaagattacaaggagacgattgaggatgccaccgagcaaagcaaccaatggctc
aacggcaaccaccttgctggggctgatcaaattgagggcaaactgaaggagctacagagc
ctctgcaactcaatgactgcaaaaatgtaccctggggcaggaggcgacatgtaa

DBGET integrated database retrieval system