KEGG   Nicotiana sylvestris: 104234621Help
Entry
104234621         CDS       T05026                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
nsy  Nicotiana sylvestris
Brite
Enzymes [BR:nsy01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     104234621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 104234621
NCBI-ProteinID: XP_009786522
UniProt: A0A1U7X310
Position
Unknown
AA seq 686 aa AA seqDB search
MESSSELVRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVLFLKRSSDRSKEVKPIVFPK
SLHVEPEEEIELEPGKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAA
DDDLYEEKLKKETVAFFMVATYGDGEPTDNAARFYKWFTEGQERGTWLQHLTYGVFGLGN
RQYEHFNKIGKVIDEQLSEQGAKRIVPVGLGDDDQCIEDDFAAWREQLWPELDQILRDED
DANSAATPYTAAIPEYRLVIHDTAASHDDKHASMANGNTSYDIHHPCQVNVAVQRELHTP
ESDRSCIHLEFDICGTGISYETGDHVGVYAENPEEIVEEAARLLGQSLDLIFSIHTDKED
GTALGGSLPPPFPGPCTLRAALARFADLLNPPRKATLVALAAHAAEPSEAEKLKFLASPQ
GKDEYSAWVVASQRSLLEVMAEFPSAKPPLGVFFAAVSPRLQPRYYSISSSPRFAPARIH
VTCALVYGPTPTGRIHKGVCSTWMKNAVPLEKSQNCSSAPIFIRPSNFKLPVDPSVPIVM
VGPGTGLAPFRGFLQERAALKEDGAQLGPALLFFGCRNRRMDFIYEEELQSFVDQGVISE
LIIAFSREGPQKEYVQHKMLEKASHVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQ
DKVDSTKAEAIVKKLQMDGRYLRDVW
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgagttcggagctggtgagatcgattgaatcggcgttaggagtgtcgttgggg
agcgatacggtgttggtgctactgacgacgtcgtttgctgtcatcgttgggttagtggtg
ttgtttttgaagagatcaagtgatcggagtaaagaagtgaagcctatcgtgttccccaag
tccttacacgtggagccggaagaggagattgagctggaacctggaaaagttaaggtcacc
gtatttttcggtactcaaactggtactgctgagggttttgccaaggctttatcagaggag
ataaaagcaagatatgagaaggcagtagtaaaagttgtggacatggatgattatgctgcc
gatgatgatctgtatgaggagaaactgaagaaagaaacagtagcatttttcatggtggca
acctatggggatggcgagcccactgataatgctgcaaggttttacaagtggttcactgag
ggacaagaacggggcacgtggctgcagcaccttacctatggagtttttggcttgggtaat
cgccaatatgaacattttaacaagattgggaaggtgatagatgaacaattaagtgaacaa
ggtgcaaaacgtattgtgcctgttggccttggtgatgatgatcagtgcattgaagatgat
tttgctgcctggcgagaacaactgtggcctgagttagatcaaatacttagagatgaggat
gatgcaaattctgcagccactccatatacagctgcaattcctgaatatcgtttggttatc
catgataccgctgcgagtcatgatgataagcatgccagcatggctaatggaaatacctcg
tatgacatccatcatccatgccaagtaaatgttgctgttcaaagggagcttcacacaccc
gaatctgatcgctcatgtatacacttggagtttgatatatgtggcactgggatttcctat
gaaacaggagatcatgtgggtgtttatgctgaaaatcctgaagaaattgttgaggaagct
gcgagattgctcgggcagtcattagacttaatattctctattcatactgacaaggaggac
ggtacagctcttggaggctcgttgcccccacctttccctggtccttgcacactgcgtgct
gcacttgcacgttttgcagatcttctgaatcctccgcggaaggctactttggttgcattg
gctgcccatgcagctgaacctagtgaagcagaaaagctcaagttcttggcatctccacag
ggcaaggatgagtattctgcatgggttgttgcaagtcaaagaagtcttcttgaagtaatg
gctgagttcccttcggcaaagcctccccttggtgtattttttgcagcggtttcccctcgt
ttacagcctcgttactattcaatctcgtcatctcctcgatttgctcctgctagaatccat
gtgacctgtgcactagtctatggtccaactcccactggccgaattcacaaaggagtgtgt
tcgacttggatgaagaatgcagttccattggaaaaaagtcaaaattgcagctctgctcca
atcttcattaggccatctaatttcaagttaccggttgacccttcagttccaattgtcatg
gtgggacctggtactggtttggcaccatttaggggattcctgcaggaaagagcagcattg
aaggaagatggggctcaacttggtcctgctttgttgttttttggttgtaggaatcgtaga
atggattttatttatgaggaggagcttcagagttttgtggatcaaggtgtaatatcagag
ctgattattgcattttcaagggaaggaccccagaaagagtatgttcaacataaaatgctg
gaaaaggcttcccatgtttggagtttaatctcccaggagggatatctatatgtatgtggg
gatgcgaaagggatggccagggatgtacatcgtacgctccataccatagtccaggagcag
gataaggtcgactcaaccaaagctgaggctattgtgaagaaactccaaatggatggaaga
tatctcagggatgtgtggtga

DBGET integrated database retrieval system