KEGG   Nicotiana sylvestris: 104234851Help
Entry
104234851         CDS       T05026                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00450  Selenocompound metabolism
nsy00970  Aminoacyl-tRNA biosynthesis
nsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    104234851
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104234851
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nsy01007]
    104234851
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nsy03016]
    104234851
Enzymes [BR:nsy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     104234851
Amino acid related enzymes [BR:nsy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   104234851
Transfer RNA biogenesis [BR:nsy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    104234851
 Prokaryotic type
   Other AARSs
    104234851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 104234851
NCBI-ProteinID: XP_009786788
UniProt: A0A1U7X7G4
Position
Unknown
AA seq 97 aa AA seqDB search
MGDSSTAGNGDYLPPTTPKLPIPGKRNILITSALPYVNNVPHLGNIIGSVLSADVFARYC
RLRNYNAIYMCGTDEYGTATETKALEENSTPKQICDK
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgggcgattcttccaccgccggcaacggcgactatctgccgccgacaactccgaaactt
ccgataccgggaaaacggaatatcctcatcacaagcgctttgccatacgtcaacaacgtt
cctcacctcggaaacatcatcggaagtgtgttgagtgcggacgtgttcgcgagatactgt
aggcttcggaattacaatgcaatatacatgtgtggtactgatgaatatggcacggctact
gagactaaagctttggaagaaaattctactcccaagcaaatttgtgacaagtaa

DBGET integrated database retrieval system