KEGG   Nicotiana sylvestris: 104236891Help
Entry
104236891         CDS       T05026                                 

Definition
(RefSeq) aldehyde dehydrogenase family 7 member B4
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00010  Glycolysis / Gluconeogenesis
nsy00053  Ascorbate and aldarate metabolism
nsy00071  Fatty acid degradation
nsy00260  Glycine, serine and threonine metabolism
nsy00280  Valine, leucine and isoleucine degradation
nsy00310  Lysine degradation
nsy00330  Arginine and proline metabolism
nsy00340  Histidine metabolism
nsy00380  Tryptophan metabolism
nsy00410  beta-Alanine metabolism
nsy00561  Glycerolipid metabolism
nsy00620  Pyruvate metabolism
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104236891
   00053 Ascorbate and aldarate metabolism
    104236891
   00620 Pyruvate metabolism
    104236891
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104236891
   00561 Glycerolipid metabolism
    104236891
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    104236891
   00280 Valine, leucine and isoleucine degradation
    104236891
   00310 Lysine degradation
    104236891
   00330 Arginine and proline metabolism
    104236891
   00340 Histidine metabolism
    104236891
   00380 Tryptophan metabolism
    104236891
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104236891
Enzymes [BR:nsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104236891
    1.2.1.8  betaine-aldehyde dehydrogenase
     104236891
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     104236891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF373
Motif
Other DBs
NCBI-GeneID: 104236891
NCBI-ProteinID: XP_009789243
UniProt: A0A1U7XQP3
Position
Unknown
AA seq 508 aa AA seqDB search
MSFAKKEYEFLKEIGIGPKNLGCYVNGTWKASGSVISTVNPANNQTIAEVVEASAQDYEE
GMQACSEAAKIWVQVPAPKRGEIVRQIGDALRANLQEFGRLVSLEMGKILPEGIGEVQEV
IDMCDFAVGLSRQLNGSIIPSERPNHMMLEMWNPLGIVGVITAFNFPCAVLGWNACIALV
CGNCVVWKGAPTTPLVTIAMTKIVASVLEKNNLPGSIFTAFCGGAEIGEAIAKDTRIPLV
SFTGSSKVGLAVQQTVNQRFGKCLLELSGNNAIIVMDDADIELAVRSVLFAAVGTAGQRC
TTCRRLLVHETVYEKVLEPLVDVYKQVKIGDPLEKGILLGPLHTRTSRENFQKGIQIIKS
QGGKILTGGSVIESEGNFVHPTIVEISSKAEVVKEELFAPVLYVMKFKTFEEAVEINNSV
PQGLSSSIFTRNPQVMFKWIGAQGSDCGIVNVNIPTNGAEIGGAFGGEKGTGGGREAGSD
SWKQYMRRSTCTINYGNELPLAQGINFG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcgcaaagaaagagtacgaatttctcaaggagatcggaattggccctaaaaat
ctaggttgttatgttaatggcacctggaaagctagtggctccgtcatctccactgttaat
cccgccaacaatcagactattgctgaagttgtagaagcttctgctcaagattatgaggaa
ggcatgcaagcttgctccgaagcagcaaaaatttgggtgcaggttcctgcaccaaaaaga
ggtgagattgtaaggcagattggtgatgcactccgagcaaatcttcaggaatttggtcgg
cttgtttcactggaaatgggaaagatactccccgaaggaattggagaggttcaagaagtc
attgatatgtgtgattttgctgtgggattgagtcggcaactgaatggatccattattcct
tctgaacgccctaaccatatgatgttggagatgtggaatccccttgggatagttggtgtg
atcacggctttcaatttcccatgtgctgtacttggatggaatgcctgtattgcgctggtc
tgcggcaattgtgttgtctggaaaggtgctccaacaacaccattggttaccatagcgatg
acaaaaattgtggctagcgtattggagaaaaacaatttacctggttcaatttttactgcc
ttctgtggtggagctgaaattggtgaagcaatagcgaaggacactcgaattccgctagtt
tctttcactgggagctcaaaggttggtcttgcagttcagcaaacagtaaatcagagattt
ggaaaatgcctactagaactaagcggaaataatgcgataatagtaatggatgatgcggac
attgaacttgctgttcgttctgttttatttgctgctgttggtacggctggtcagcgctgt
acaacgtgccggagactgcttgttcacgagacagtttatgagaaggtacttgaaccacta
gttgatgtgtacaagcaagtaaagataggggaccctttagaaaaaggtatcttacttggg
ccactgcatactcgcacttctagggaaaactttcagaagggaatccaaattatcaagtcc
cagggtggaaagatccttacaggtggttcagtcatagaatctgagggtaactttgtgcat
ccaacaattgttgaaatatcttcaaaagctgaagttgtgaaggaagaattgtttgctcca
gttctttatgtaatgaagtttaagactttcgaagaagcagttgaaattaacaactctgtc
cctcaaggtttaagtagttccatcttcacccgaaatccacaagttatgtttaagtggatt
ggagctcaaggaagtgactgtggcatcgtcaatgtaaacataccaacaaatggagctgaa
attggtggtgcttttggaggtgaaaaaggtaccggtggtggccgtgaggcaggaagtgat
tcttggaaacaatatatgaggcgctcaacttgtacaatcaattatgggaatgaactacca
ttggcgcaaggaatcaattttggctaa

DBGET integrated database retrieval system