KEGG   Nicotiana sylvestris: 104237330Help
Entry
104237330         CDS       T05026                                 

Definition
(RefSeq) beta-galactosidase 17 isoform X1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00052  Galactose metabolism
nsy00511  Other glycan degradation
nsy00531  Glycosaminoglycan degradation
nsy00600  Sphingolipid metabolism
nsy00604  Glycosphingolipid biosynthesis - ganglio series
nsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104237330
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    104237330
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    104237330
   00604 Glycosphingolipid biosynthesis - ganglio series
    104237330
   00511 Other glycan degradation
    104237330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nsy04147]
    104237330
Enzymes [BR:nsy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     104237330
Exosome [BR:nsy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104237330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 BetaGal_dom4_5 F1F0-ATPsyn_F
Motif
Other DBs
NCBI-GeneID: 104237330
NCBI-ProteinID: XP_009789763
UniProt: A0A1U7XFW0
Position
Unknown
AA seq 489 aa AA seqDB search
MVKMGQIENEFGSYGDDKAYLHHLARIARRHLGDDVILYTTDGGSRENLNKGTIPGDTVF
SAVDFTTGDDPWPNFKLQKEFNAPGKSPPLSTEFYTGWLTHWGEHIANTDATVTATYLER
ILSRNGSAVLYMAHGGTNFGFYNGANTGADESDYKPDLTSYDYDAPIKESGDIDNPKYQA
LRRVIAKYTAAPLASVPPNNEKKAYGLIKLQKTKSLFNIIDTKYFDGVTESEDPLAMESL
GQMFGFMFYVSDYKAKANGSLLFIPKVRDRGQVFISCPSNSNEEIPKYVGTIARWSNTPI
RLPHTQCSSGSKIYILVENMGRINYGQYIFDKKGILSPVYLDGEPLHKWKMLPIPFHNLN
EDQQINSVISDAYTNLGNSVRKNLKNRINYHPEPAFYAGHLTVDEVKDTFLSFRGWSKGV
AFINGYNIGRFWPSFGPQCNLYVPAPFLHKGKNLLVILELEVPNAELFVTSVDQPDFTCG
SANSKVHQI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaatgggacagatagaaaatgaatttggttcatatggagatgacaaggcctac
ctgcatcatttagcaaggatagcccgcagacaccttggagatgatgttattctatatact
acagatggaggttcaagagaaaatcttaacaaagggactattcctggggatactgtcttt
tcagctgtcgattttacaactggagacgatccatggcccaattttaagttgcaaaaagag
ttcaatgcaccagggaaatcaccacctctttctacggagttctacactggctggctcacg
cactggggagagcatattgcaaatactgatgcaactgttacagcaacttacttagaacgg
atcttgtcaagaaatggatcagctgtgctctacatggcgcatggtggaacaaattttggg
ttttataatggtgcaaatactggtgcagacgagtctgattacaagcctgatcttacatcc
tatgattatgatgcacctatcaaagaatctggcgacattgacaatccaaaataccaagct
cttcggagggtgattgcaaaatatactgcagcgcctcttgcctcagttcctcccaataat
gaaaagaaagcatatggccttattaagttgcagaagactaaatctctgttcaacataatt
gatactaaatactttgatggtgtcactgaatctgaagacccacttgcaatggagtctttg
ggccagatgtttggcttcatgttttatgtttctgattacaaagcaaaagctaatggaagt
ttgttgttcataccaaaggtgcgtgacagggggcaagtattcatttcatgcccttcaaac
agcaatgaagaaattccaaaatatgtaggcactatagctagatggtcaaatactccaatc
aggcttcctcatactcaatgttcttctggtagcaaaatttatatactggtagaaaatatg
gggcgtataaactatgggcaatatatctttgacaagaagggtatactgtctcctgtttat
ttagatggcgagccgctgcataagtggaaaatgttgcctattccttttcacaatctgaat
gaggatcaacagattaattctgttatttcagatgcatacaccaaccttggaaattctgtg
cggaagaatctgaaaaatagaataaattatcatccagagccagctttctatgctggtcat
cttacagttgatgaagtgaaagacacttttttgtcatttcgtggctggagtaaaggggtt
gcatttatcaatggatataatataggaagattttggccgtcctttgggccacagtgtaac
ctttatgttcccgctccgttcctgcacaaagggaaaaaccttttggtcattcttgagtta
gaggttccaaatgctgagttgtttgtgacctcagttgaccaaccggatttcacatgtggt
tccgcaaattcaaaagtgcatcaaatctga

DBGET integrated database retrieval system