KEGG   Nicotiana sylvestris: 104241066Help
Entry
104241066         CDS       T05026                                 

Definition
(RefSeq) stromal 70 kDa heat shock-related protein, chloroplastic-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
nsy  Nicotiana sylvestris
Pathway
nsy03040  Spliceosome
nsy04141  Protein processing in endoplasmic reticulum
nsy04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104241066
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104241066
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104241066
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nsy01009]
    104241066
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nsy03041]
    104241066
   03009 Ribosome biogenesis [BR:nsy03009]
    104241066
   03110 Chaperones and folding catalysts [BR:nsy03110]
    104241066
   04131 Membrane trafficking [BR:nsy04131]
    104241066
   03051 Proteasome [BR:nsy03051]
    104241066
   03029 Mitochondrial biogenesis [BR:nsy03029]
    104241066
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nsy04147]
    104241066
Protein phosphatases and associated proteins [BR:nsy01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104241066
Spliceosome [BR:nsy03041]
 Complex B
  Other components
   Prp19 complex
    104241066
 Complex C
   Prp19-CDC5 complex
    104241066
Ribosome biogenesis [BR:nsy03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    104241066
Chaperones and folding catalysts [BR:nsy03110]
 Heat shock proteins
  HSP70 / DNAK
   104241066
Membrane trafficking [BR:nsy04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    104241066
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104241066
Proteasome [BR:nsy03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104241066
Mitochondrial biogenesis [BR:nsy03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    104241066
Exosome [BR:nsy04147]
 Exosomal proteins
  Proteins found in most exosomes
   104241066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA Hydantoinase_A PilM_2 DUF5398 SRA1 CBFNT StbA
Motif
Other DBs
NCBI-GeneID: 104241066
NCBI-ProteinID: XP_009794281
UniProt: A0A1U7XXD8
Position
Unknown
AA seq 692 aa AA seqDB search
MSSIMAATATHQVKIPGFSGLKLDKKTPCFVSREKCYSNKGVLRQKYRPMKIVNEKVVGI
DLGTTNSAVAVMEGGQPTIVTNAEGQRTTPSVVAYTKNGDRLVGQIAKRQAVVNPENTFF
SVKRFIGRKMTEVDEESKQVSYRVMKDENGNVKLECPAIGKQFAPEEISAQVLRKLVDDA
SKFLNDKVAKAVVTVPAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGFEKKNNE
TILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRTVDWLAENFRKEEGIDL
LKDKQALQRLTEAAEKAKIELSTLTQTNISLPFITATADGPKHIETTLTRAKFEELCSDL
LDRLKTPVETALKDANLSFKDIDEVVLVGGSTRIPAVQNLVRKMTGKEPNVSVNPDEVVA
LGASVQAGVLAGDVSDIVLLDVTPLSLGLETLGGVMTKIIPRNTTLPTSKSEVFSTAADG
QTSVEINVLQGEREFVKDNKSLGRFRLDGIPPAPRGVPQIEVKFDIDANGILSVTATDKG
TGKKQDITITGASTLPKDEVDRMVQEAEKFAKEDKEKRDSIDTKNQAESVVYQTEKQLKE
LGDKVPADVKDKVESKLRELKDAIAGGSTQTIKDTMAALNQEVMQLGQSLYSQPGAAAGP
AGAAAGPAGASGSRGKDDGDGEVIDADFSESN
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaattatggctgcaactgcaacccaccaagtgaaaatccccggattttccggg
cttaaactcgacaagaaaacaccatgctttgtatcaagagagaaatgttacagcaacaaa
ggagtattgaggcaaaagtacagacccatgaaaatagtgaacgagaaggtggtggggata
gatttaggtacaacaaactcagcagtggcagtaatggaaggtggacaaccgacaatagtg
acaaatgcggagggacaaagaacgacgccgtctgtggtggcgtatacgaaaaacggcgat
agattagtcgggcaaatagcgaaaaggcaagcggtggtaaatcctgagaatacttttttc
tcggtaaagagatttatagggaggaagatgacggaggttgatgaagaatcgaagcaggta
tcgtatagagtgatgaaggatgagaatgggaatgttaaacttgagtgtcctgctattggt
aagcagtttgctcctgaggaaatttctgctcaggtcttaaggaagcttgttgatgatgcc
tcaaagttcttgaatgataaagttgctaaagcagtggttacagtacctgcatacttcaat
gactcccagagaactgcaacgaaagatgcaggtcgcattgccggattagatgttctccgc
ataattaacgaacccactgctgcttcattggcttatggatttgagaagaagaataacgaa
accattctagtgtttgacctgggaggtggtacttttgatgtgtcagttcttgaggttgga
gatggagtatttgaggtgctctctacctcaggcgacacacacttgggaggtgatgatttt
gataagagaactgtcgactggcttgctgaaaatttccgaaaagaagaaggaatagacctt
ctgaaggataaacaagcgcttcaacgtcttactgaagctgctgaaaaggcaaagatagaa
ttgtcaaccttgactcaaactaatatcagtttgccattcatcactgctactgcagatggt
ccaaaacatattgagacaacacttacaagggccaagtttgaggagttatgctcagactta
ttggacaggcttaaaacaccagttgaaactgccttgaaggatgccaacctttccttcaaa
gatatagacgaagtagttcttgttggtggatcgacacgaataccagctgttcaaaacctt
gtccgcaagatgactggtaaagagcctaatgtttctgtcaatcctgatgaggtagttgct
cttggagcttcagttcaggctggtgtcttggctggagatgttagtgacatcgtgttatta
gatgtaacaccattgtcacttggtctggaaactctaggtggagttatgacaaaaatcatc
ccacgaaatacaacactaccgacttcaaagtcagaagtcttctcaactgcggcagatggg
caaaccagtgttgagattaatgtgctacaaggtgaaagagagtttgtaaaagacaacaag
tctcttggaaggttccgtctggatgggattcctccagctcctcgtggtgttccccagatt
gaagtaaaatttgatattgatgccaatggtattctctctgtcacggctactgataagggt
accggaaagaagcaggacattactataaccggtgctagcactttgcccaaagatgaggtt
gatagaatggttcaggaagctgagaagtttgctaaagaggacaaggagaagagggattcc
attgacacaaagaaccaagcagaatctgttgtatatcaaactgagaagcagctaaaagag
ttgggagacaaggtgccagctgatgttaaagacaaggtggaatcgaaactgagagagctc
aaggatgccatagctggcggttcaacacaaaccattaaggacacaatggctgcgttgaac
caagaagtcatgcagctgggacagtctctatacagccagccaggtgctgctgctggtcct
gctggtgctgctgctggtccggcaggggcatctggttccaggggcaaggatgatggagat
ggagaagtaatcgatgcagacttcagcgaaagcaattaa

DBGET integrated database retrieval system