KEGG   Nicotiana sylvestris: 104245000Help
Entry
104245000         CDS       T05026                                 

Definition
(RefSeq) mitogen-activated protein kinase 7-like
  KO
K20537  mitogen-activated protein kinase 7/14 [EC:2.7.11.24]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    104245000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nsy01001]
    104245000
Enzymes [BR:nsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104245000
Protein kinases [BR:nsy01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104245000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo APH Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104245000
NCBI-ProteinID: XP_009798838
UniProt: A0A1U7Y6U9
Position
Unknown
AA seq 370 aa AA seqDB search
MATQVEPPNGIRPRGKHYYTMWQTVFEVDTKYIPIKPIGRGAYGVVCSSVNRETNERVAI
KKINNVFSNRIDALRTLRELKLLRHIRHENVIALKDVMMPIHRSSFKDIYLVYELMDTDL
NHIIKSSQPLSNDHCKYFLFQLLRGLKYLHSANILHRDLKPGNLLVNANCELKICDFGLA
RTSRDNGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEILGRKPLFPGTECL
NQLTLILNILGSQPEADLHFIDNQRAKRFIRSLPFSRGTHFSSLFPQADPLAIDLLQRML
VFDPSKRITVTEALYHPYLSSLYDPTCNLPAQFPLNLDIDENMAEPLIREMMLREILHYH
PEAAYINTFY
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcaagtggagcctccaaatggaattaggcctcgagggaaacactattacaca
atgtggcaaactgtatttgaagttgacacaaaatacattccaattaaacctattggaaga
ggagcttatggtgtggtttgttcctcagtaaatagggagactaatgagagagttgctatc
aagaagatcaataacgtgttttcgaatagaattgatgcgctgagaacactgagagaattg
aagcttttgcggcatataaggcatgagaatgtgattgctttgaaggatgtcatgatgcct
attcatagaagcagttttaaggatatttatttggtttatgagttgatggatacggatctt
aatcatatcattaagtcgtcgcagcctttatctaatgaccattgcaagtattttcttttt
cagctccttcgtggcttgaagtatctccattcagctaacattctccaccgggacttgaaa
cctgggaatctccttgtgaacgctaactgtgagttaaagatttgtgactttggactggct
aggactagcagagacaatgggcagtttatgactgaatatgtagtcactcgttggtatcgt
gcaccagagcttcttctttgctgtgacaattatggaacatccattgacgtctggtctgtt
ggatgtatctttgcggaaatccttggacgaaagcctctcttcccaggaactgagtgcctc
aatcagcttacacttattctcaatatccttggtagccagcctgaagctgatcttcatttc
attgataaccaaagggctaaaagattcatcagatcactacctttttctcgaggaacacac
ttttcttctctcttccctcaggctgatcctttagcaatagatttactgcagcgaatgctg
gtttttgatccctctaagagaataacagttacagaagctctctatcacccgtacctatcg
agtctttatgatccaacttgcaaccttcctgctcaatttcctctcaatttggatatcgat
gagaatatggcagaaccattgattcgggagatgatgctgagagaaatccttcattaccat
cctgaagcagcttacatcaacacattttactag

DBGET integrated database retrieval system