KEGG   Nicotiana sylvestris: 104246222Help
Entry
104246222         CDS       T05026                                 

Definition
(RefSeq) proline-rich receptor-like protein kinase PERK3
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
nsy  Nicotiana sylvestris
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nsy01001]
    104246222
Enzymes [BR:nsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104246222
Protein kinases [BR:nsy01001]
 Serine/threonine kinases: TKL group
  IRAK family
   104246222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr ABC1 TMEM154 Ninjurin Adeno_E3_CR2 Kdo DUF5385
Motif
Other DBs
NCBI-GeneID: 104246222
NCBI-ProteinID: XP_009800291
UniProt: A0A1U7YEA9
Position
Unknown
AA seq 339 aa AA seqDB search
MNRGEIIIIYNVILVILSIIITILVILLFICCKKKPIKAEETLPTKQSASSYSLMDIHTA
TDGFNYRRIIGQGRIGSVYAAILPNGEQVAVKRIHPSLVLSNAGLGFSSIMKWLSLVDHP
NIVSILGFSEAPGERIVVMEYEGMLSLDFYLHQNYDGVALLDWSCRLRIAANVAKGIEYL
HEVMAPNIIHGCIKPSNILIDVKFCARVCDYGLYFFLGNNYERKLGLMGYVDDEYWIEKK
GGSKESDVYGLGVVLLELLSGRRNSDNQENLLVKWALPLIKEMKFSEFLDPRLVIPSDIR
PIVRLAKVALACVGNSRKSRPSIVQVAAILTSLEVGLSF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtggagagatcataattatttataatgttattttggttatactctcaattatt
atcacaattcttgttatcctcctcttcatttgttgcaagaaaaaaccaatcaaagctgaa
gaaactcttccaacaaaacaaagtgcatcttcttattctttaatggatattcatacagct
acagatggattcaactatcgtagaatcatcggtcaaggccgaataggaagcgtctacgcc
gccatattaccaaacggagaacaagtagcagtgaaaagaatacatccaagtttagtttta
agcaatgctggcttaggtttttcgtcgataatgaaatggctttctttagttgatcatccg
aatatcgtgtcaattttagggttttctgaagctccaggtgaaagaattgttgttatggaa
tatgaaggtatgttaagtttggatttttatttacatcaaaattatgatggtgtagctcta
ttggattggagttgtaggttaagaattgctgcaaatgttgctaagggtatagaatatttg
catgaagttatggcacctaatataatacatggttgtattaaaccatcaaatatattaata
gatgttaagttttgtgctagggtttgtgactatggtttgtatttttttttgggaaataac
tatgaaaggaaattagggttaatggggtatgtagatgatgaatattggattgaaaaaaaa
ggtggttcaaaggaaagtgatgtgtatggattaggtgtggttttgttggagttgttgagt
ggaagaagaaatagtgataatcaagaaaatttgcttgtgaaatgggcattgcctttgatt
aaagaaatgaagtttagtgaatttttggacccaagacttgttataccaagtgatattaga
cctattgttagattggctaaagttgctttagcttgtgttggaaattcaagaaaaagtaga
ccttcaattgttcaagttgctgctattttgactagcttagaagttggattaagcttctga

DBGET integrated database retrieval system