KEGG   Nicotiana sylvestris: 104246276Help
Entry
104246276         CDS       T05026                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00520  Amino sugar and nucleotide sugar metabolism
nsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    104246276
Enzymes [BR:nsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     104246276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short TrkA_N
Motif
Other DBs
NCBI-GeneID: 104246276
NCBI-ProteinID: XP_009800368
UniProt: A0A1U7YB65
Position
Unknown
AA seq 431 aa AA seqDB search
MKLHTQSSMNHRRDEEMSMSISKNTTPPSSPKPLKHPRSLPRSINYLLKEQRLLFILVGI
LIGSTFFILQPSLNPSSPIPNSSFHVSESVPLTHTSTVTTSFKTWRVPVGIGKKRMRIVV
TGGAGFVGSHLVDKLIKRGDDVIVIDNFFTGRKENVMHHFGNHRFELIRHDVVEPILLEV
DQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRIGARFLLTSTSEVYGDPLEHP
QKETYWGHVNPIGVRSCYDEGKRTAETLTMDYHRGAGVEVRIARIFNTYGPRMCLDDGRV
VSNFVSQAIRRQPMTVYGDGKQTRSFQYVSDLVDGLMALMEGEHIGPFNLGNPGEFTMLE
LAEVVKEVIDPSATIEFRANTADDPHKRKPDISKAKELLNWEPKVPLREGLPLMVNDFRN
RILNEDEGKGN
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcacacgcaatcaagtatgaatcacagaagagatgaagaaatgtcaatgtca
atatcaaaaaacacaaccccaccttcttccccaaagcctctcaaacaccccagatctcta
cctagatccattaattacctccttaaagaacaacgccttctcttcatattagttggcatt
ctcattggctcaacatttttcattctccagcccagtctaaacccatcttctccaattccc
aattcatcatttcacgtttccgaatccgttcccttaacccacacatcaaccgttacgacg
tcgtttaagacatggcgggtcccagttgggatagggaaaaaacgcatgcggattgtagtg
actggtggggccggttttgtagggagtcatttggttgataagttaattaaacgaggtgat
gatgttattgtgattgataatttttttactgggaggaaagaaaatgtgatgcatcatttt
gggaatcatagatttgaattaataagacatgatgttgttgagcctattttgttagaagtg
gatcagatctaccacttggcttgccctgcttctcctgttcattacaagtataatcctgtc
aaaactattaagacaaatgtgatgggtacgcttaacatgttgggacttgccaaaagaatt
ggtgcgcggttcttgcttactagtacaagtgaggtttatggtgatccacttgagcatcca
caaaaagaaacatattggggacatgtgaatccaataggggttaggagctgctatgatgag
gggaaacgaactgctgaaaccttgactatggattaccatcgtggtgcaggtgttgaggtg
cgtattgcccgaattttcaatacatatggacctcgcatgtgtctcgatgatggacgtgtt
gtcagcaactttgtttcccaggccatccgcaggcaaccaatgacagtctatggtgatggg
aagcagacacgaagctttcagtatgtatctgatttggttgatggattaatggccttaatg
gaaggtgagcatattggccctttcaacttgggaaacccaggagagtttaccatgttagag
cttgccgaggtggtcaaagaagtgattgatccaagtgctactattgagttcagagctaac
acagctgatgatcctcacaagaggaaaccagatatcagcaaagcaaaggaactactaaac
tgggagcccaaagtacccttgcgcgaggggctgccactcatggtcaatgattttcgcaat
cgcattctaaatgaagatgaagggaaaggaaactaa

DBGET integrated database retrieval system