KEGG   Nicotiana sylvestris: 104248444Help
Entry
104248444         CDS       T05026                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase-like
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00072  Synthesis and degradation of ketone bodies
nsy00280  Valine, leucine and isoleucine degradation
nsy00650  Butanoate metabolism
nsy00900  Terpenoid backbone biosynthesis
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
Module
nsy_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104248444
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    104248444
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104248444
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    104248444
Enzymes [BR:nsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     104248444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III_C Microtub_bd
Motif
Other DBs
NCBI-GeneID: 104248444
NCBI-ProteinID: XP_009803000
UniProt: A0A1U7YW78
Position
Unknown
AA seq 463 aa AA seqDB search
MAPPQQKNVGILAIEIYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMGFCTEVEDVISM
SLTAVTSLLEKYAVDPKQVGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNA
CYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPIV
FESKIRASHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDACYKSLCNKYEKLEGKQF
SIADAAYFVFHSPYNKLVQKSFARLLFNDFLRNACSIDKSAKEKLAPFLSLSGDESYQSR
DLEKTSQQVAKPFYNEKVQPTTLIPKQVGNMYTASLYAAFASLLHNKHNTLAGQRVMLFS
YGSGSTATMFSLKLNEGQHPFSLSNIASAMNVAEKLKSRHELVPEKFVEIMQLMEHRYGA
KDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKASENGLVNGH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcacctcctcaacagaagaatgtcggaatcctcgccatagaaatttacttccccccc
acttgcattcagcaggaagtattggaagctcatgatggagcaagcaaagggaaatacaca
attggtcttggacaagattgtatgggcttttgcactgaggttgaagatgttatatcaatg
agtttgacagctgttacttcccttctggagaagtatgctgttgatccaaagcaagttggt
agactggaagttggaagtgagactgttatcgataaaagcaaatccatcaagacgttcctg
atgcaaatatttgagaaatgtgggaatactgacattgaaggagttgactcaactaatgca
tgctatggtggaactgctgcattgttcaactgtgtgaattgggtggagagctcttcatgg
gatggacgttatggacttgttgtatgcacagatagtgcggtctatgctgaaggacctgct
aggccaactggaggagctgctgccattgctatgctaattgggcctaatgcccctattgtt
tttgaaagcaagatcagggctagccatatggctcatgtctatgatttttacaagcctatc
ctagacagtgaatatccagtggttgatggcaagctttcacaaacttgttatctcatggca
cttgatgcttgctacaagagcttatgcaacaaatatgagaaattggaaggcaagcagttt
tcgattgctgatgcagcctactttgtgttccattcaccgtacaacaagcttgtacaaaag
agctttgctcggttgcttttcaatgactttttgaggaatgcttgctctatcgataaatct
gccaaagaaaagcttgcaccatttttgtccctaagtggtgatgaaagctaccaaagccgt
gatcttgagaagacatcccagcaagttgcaaaaccattttacaatgagaaggtgcaacct
accacattaataccaaaacaagttggcaacatgtacactgcttctctatatgctgctttt
gcatcactccttcacaataagcacaacacgttggctggacagcgggtaatgttgttctcc
tatggtagtggatcaactgcaacaatgttctcactcaagcttaatgaaggtcaacatcct
tttagcttgtcaaacattgcaagcgcgatgaatgttgcagagaagttgaaatcaagacac
gagttggttcctgaaaaattcgtcgaaataatgcaactaatggagcatagatatggggcc
aaggatttcgtcacaagcaaagattgtagtcttctagctccaggaacttactacctcaca
gaggttgattccaagtacagaagattctatgccaagaaagcttctgagaatggactggtg
aatggtcactga

DBGET integrated database retrieval system