KEGG   Nicotiana sylvestris: 104249284Help
Entry
104249284         CDS       T05026                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00052  Galactose metabolism
nsy00500  Starch and sucrose metabolism
nsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104249284
   00500 Starch and sucrose metabolism
    104249284
Enzymes [BR:nsy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104249284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104249284
NCBI-ProteinID: XP_009803979
UniProt: A0A1U7YXU6
Position
Unknown
AA seq 580 aa AA seqDB search
MEFLRNSSLWSLQILLLGVFVFVSNNGGVDASHKVYMHLQSTSSNVKNVHRTGYHFQPPK
NWINDPNGPMYYNGVYHLFYQYNPKGAVWGNIVWAHSVSTDLINWIPLEPAIYPSKIFDK
FGTWSGSATILPGNKPIILYTGIIDANRTQVQNYAIPANLSDPYLRKWIKPDNNPLIVAD
MSINKTQFRDPTTAWMGRDGHWRILVGSVKNHRGKVILYRSKDFMKWTKAKHPLHTATNT
GNWECPDFFPVSLKHTNGLDTSYRGEYTKHVLKVSLDVTRFEYYTVGTYDTRKDRYIPDN
TSVDGWKGLRLDYGNYYASKSFFDPSKNRRIMLGWANESDTVDDDVRKGWAGVHPIPRKL
WLDPSGKQLVQWPVEELETLRKKKVQLSNHKLYKGEMIEVKGITVAQADVEVTFSFASLD
KAEPFDPSWADLYAQDVCAIKGSTVQGGLGPFGLITLASKNLEEYTLVFFRVFKAQDKYK
VLMCSDASRSTLKNETTMYKPSFGGYVDVDLADKKLSLRSLIDNSVVESFGAGGKTCITS
RVYPTLAIFDKAHLFAFNNGTEAITIETLNAWSMADAKLH
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggagtttttaagaaactcttctctttggtctttgcaaattcttttgttgggtgtcttt
gtttttgtttcaaacaatggtggtgtcgatgcttctcacaaagtctatatgcatttgcaa
tctactagctctaatgtcaagaatgttcacagaactggttaccattttcaaccacctaaa
aactggattaacgatccaaatggcccaatgtattacaatggagtctaccatctattctac
caatacaacccaaaaggagcagtatggggcaacattgtttgggcccattcagtctcaaca
gatttgattaattggataccacttgagcctgctatttacccttccaaaatatttgacaag
tttggaacatggtcaggttcagctacaattttgccaggcaacaagcccattatcctctac
actggaattatagatgctaacaggacacaagtccaaaactacgcgatcccggctaacttg
tccgatccatatctccgtaaatggatcaagcccgataacaatccgttaatcgttgctgac
atgagcatcaacaagactcaatttcgcgacccaacgacagcttggatgggccgagatggt
cattggagaatcttggttgggagtgtgaagaatcatagaggaaaggtaatattgtataga
agtaaggacttcatgaaatggactaaagccaaacatccacttcatacagctaccaatact
ggaaattgggaatgtcctgattttttcccagtgtcactaaagcatacaaatggtttggac
acctcatatcgtggcgaatacactaagcatgttcttaaggttagccttgatgttacgagg
tttgagtactacacagtcggtacctatgacactagaaaagataggtacattccggataac
acttctgttgatggttggaagggattgagacttgactatggtaattattatgcgtccaag
tcattctttgaccctagcaagaaccggagaattatgttgggttgggctaatgaatcagat
actgttgatgacgatgtcaggaaaggatgggccggagtccaccctatcccgcgtaaacta
tggcttgatccaagtggaaagcaattggttcaatggcctgttgaagaattagaaactcta
agaaagaaaaaggtccaactaagtaatcacaagttgtacaagggagaaatgattgaagtc
aaaggaatcacagttgcacaggctgatgttgaagtgactttctcgttcgcaagtttggac
aaggcagaaccatttgatcctagttgggctgatctttacgcgcaagatgtatgcgccatt
aagggttcaacagtccaaggtggactcgggccatttggactcataactttggcttctaaa
aacttggaagaatacacacttgttttcttcagagtttttaaagctcaagataaatataag
gttcttatgtgctctgatgcatcaaggtcaacccttaagaatgaaacaactatgtacaaa
ccatcatttggtggatatgtggatgtggatttagcagacaagaagttgtctctaaggagt
ttgattgataactcagtagtggaaagttttggtgccggaggaaaaacatgtattacatca
agagtttatccaacattagcaatatttgataaggcacatttatttgccttcaacaatggc
acagaagcaatcacaattgaaactctaaatgcctggagtatggccgatgctaagctgcac
taa

DBGET integrated database retrieval system