KEGG   Nicotiana sylvestris: 104250165Help
Entry
104250165         CDS       T05026                                 

Definition
(RefSeq) sulfhydryl oxidase 2-like isoform X1
  KO
K10758  thiol oxidase [EC:1.8.3.2]
Organism
nsy  Nicotiana sylvestris
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104250165
Enzymes [BR:nsy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     104250165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Evr1_Alr Thioredoxin OST3_OST6 AhpC-TSA Thioredoxin_4
Motif
Other DBs
NCBI-GeneID: 104250165
NCBI-ProteinID: XP_009805038
UniProt: A0A1U7YPM7
Position
Unknown
AA seq 521 aa AA seqDB search
MTFCSVFLLLFLILLFSSFEQSVSISSGSQRVILRSIINENSKDGDFAIDLNATNFDSVL
KETPAPFAIVEFFAHWCPACRNYKPQYEKVARLFNGADASHPGIILMTRVDCASTINSKL
CDKFSVDRYPMLFWGPPKKFVSGGWVPKQGKSEIIPIESGRTADVLLGWINKQLGSSYSL
DDGKYENEHLQTNTSDPGQIAKAIYDVEEATSTAFSIILDHKMIKPETRTSLIKFLQLLV
AHHPSRRCRKGSADVLVNFDDLCPSSTMLVNNEEAESCSKNGVLENYQICGKEVPRGYWM
YCRGSKNDTRGFSCGLWILLHSLSVRVEDGESNMAFRSTCDFVHNFFVCEECRQHFYEMC
SSVSTPFKKARDFALWLWRAHNKVNERLIKEEASLGTGDPEFPKAIWPPKQQCSSCYLSP
SKTSKENSKIDWDENEVFKFLVSYYGKELVTLYKESEQRGSGQTEKIVAEELVASTNAVV
VPVGAALAIAVASCAFGALAYIWRSRQKNRKYKYIYSLKNI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgactttttgttctgtatttttgttactattcttgattctattattttcaagctttgaa
caatcagtttcaatatcaagtggatctcaacgtgtgattcttcgatcaatcataaatgaa
aatagcaaagatggtgattttgctattgatttaaatgccaccaactttgattctgttctt
aaggaaactcctgcaccttttgccattgttgaattctttgctcactggtgtcccgcttgt
agaaattataagccacaatatgaaaaagttgcaagactcttcaacggggcagatgctagt
catccaggaatcatattaatgacacgggtagattgtgcatcgacgataaattctaagctt
tgtgacaagttctccgtggatcggtacccgatgcttttttggggacctcctaagaagttt
gttagtggtggttgggttccaaaacaaggaaagagtgaaataattccgattgaaagtgga
cgaactgctgatgtcttgcttggctggatcaacaaacaactgggaagctcatacagtttg
gatgatggaaaatacgagaacgagcatcttcagacaaacacttcggatcctggccagatt
gccaaagctatctatgatgttgaggaggcaacatctactgcctttagtattattttagac
cacaagatgattaaaccagaaactcggacatcacttataaagtttcttcagcttttggtt
gctcatcacccttctaggaggtgccggaaggggagtgcagatgtacttgttaactttgat
gatctgtgtccatcatctacgatgttggttaacaatgaggaagctgaaagttgtagcaaa
aatggcgtgctggaaaattaccagatttgtggtaaagaggttcctcgcggatattggatg
tattgtcgtggcagcaagaatgatactagaggttttagttgcggtttgtggattttgtta
cattcactctccgtaagagtggaggacggagaaagcaacatggcatttagaagtacttgt
gattttgtacacaactttttcgtctgtgaggagtgtaggcaacacttttacgaaatgtgc
tcaagcgtgtctactccattcaagaaagcacgtgattttgctctctggttgtggcgtgct
cacaacaaggtcaacgaaagactaataaaagaagaagcgtcccttggaactggcgatcct
gaattcccaaaagctatttggcctccaaaacagcaatgttcatcgtgttacctcagcccg
agcaagacgagcaaggaaaatagtaagatcgattgggatgagaacgaggtctttaagttt
ttggtcagttactatgggaaagaactagtaactctctataaggaaagtgaacagcgaggt
agtggtcagaccgaaaaaatagttgccgaagagttggtagcctcgacaaatgcagttgtg
gttccagtgggagctgcattggctattgcagttgcgagctgtgcattcggagcgcttgca
tacatctggcgctcacgacaaaagaaccggaagtataaatatatatactctttaaagaat
atatga

DBGET integrated database retrieval system