KEGG   Nicotiana tabacum (common tobacco): 107759041Help
Entry
107759041         CDS       T04643                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1-like
Organism
nta  Nicotiana tabacum (common tobacco)
SSDB OrthologParalogGFIT
Motif
Pfam: DOCK-C2
Motif
Other DBs
NCBI-GeneID: 107759041
NCBI-ProteinID: XP_016432394
UniProt: A0A1S3WXQ5
Position
Un
AA seq 383 aa AA seqDB search
MKELVPHYLQDSAKERLDYLEDGKNIFKLRLRLCSSLYPVSERIRDFFLEYDRHTLRTSP
PWGSELLEAINSLKNVDSTALLQFLYPILNMLLHLIGNGGETLQVAAFRAMVNILTRVQQ
ESVDEAERNAFLVNFVDYAFDDFGGRQPPVYPGLSTVWGSLARSKAKGYRVGPVYDDVLA
MAWFFLELIVKSMALEQARSFYHNLPSGEDVPPMQLKEGVFRCVVQLYDCLLTEVHERCK
KGLSLAKHLNSSLAFFCYDLLSIIEPRQVFELVSLYLDKFSGVCQTVLHDCKLTFLQIIC
DHDLFVEMPGRDPSDRNYLSSILIQEIFLTWDHDDLSMRAKAARILVVLMCKHEFDIRYQ
KQEDKLYIAQLYFPLVGQVRDSN
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattagttcctcattatcttcaagatagtgccaaggagaggctggattacttg
gaagatggcaagaatatattcaagcttcgtttacgactatgttcatcattgtacccagtt
agtgaacgcattagggattttttccttgagtatgataggcacactcttcggacaagtccc
ccttggggatctgagcttcttgaggcaattaatagcctgaagaatgttgattccactgct
ttgcttcaatttctttatccgatcttaaacatgcttctccatcttattggcaacggggga
gaaactcttcaggttgctgcatttagagcaatggttaacattttaacaagggtgcagcag
gagtctgttgatgaagctgagagaaatgctttcctagtaaactttgttgattatgctttt
gatgattttgggggtcgtcagccaccagtctatcctggtttgtccacagtgtggggaagt
ttggctcgcagtaaggcaaaagggtaccgcgttgggccagtctatgatgatgtcctggca
atggcttggttttttcttgagctgattgtcaagtcaatggcactggagcaggctcgatcc
ttctatcacaatcttccatcgggtgaagatgtcccgccaatgcagttgaaagaaggtgtt
tttagatgtgttgttcaattgtatgactgccttctaacagaagttcatgaacgctgcaag
aaaggtctaagcttggccaagcatttaaacagtagtttggctttcttttgttatgatctg
ttatccatcatcgagcctcgacaggtttttgaactggtatccttgtacctcgataaattc
tctggagtgtgtcagacggtgctgcatgactgcaagcttacttttctacaaattatatgc
gatcacgatctttttgttgaaatgcccggacgagatccttctgataggaattatctttca
tctatcttaattcaagagattttccttacatgggatcatgatgacttatcaatgagggca
aaagctgcaagaatcctggtggtcctcatgtgtaagcacgagtttgatattcgttaccaa
aagcaagaggataaattatatattgctcaattatattttccccttgttggccaggtgcgt
gattctaattaa

DBGET integrated database retrieval system