KEGG   Nicotiana tabacum (common tobacco): 107761518Help
Entry
107761518         CDS       T04643                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00520  Amino sugar and nucleotide sugar metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    107761518
Enzymes [BR:nta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     107761518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-GeneID: 107761518
NCBI-ProteinID: XP_016435227
UniProt: A0A1S3X5S8
Position
Un
AA seq 433 aa AA seqDB search
MKLHKQSSRRDEEIPNSQISLPYSPKTLKHPTRSLPRSINYLLKEQRLLFILIGILIGST
FFIFQPSLSLLSTSSEPHSSIPRSYNALNHESLSTISSYNNVPIFKGRVPVGVGRKRMRI
VVTGGAGFVGSHLVDKLIKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILL
EVDQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRIGARFLLTSTSEVYGDPLE
HPQKETYWGHVNPIGVRSCYDEGKRTAETLTMDYHRGAGVEVRIARIFNTYGPRMCLDDG
RVVSNFVAQAIRNQPMTVYGDGKQTRSFQYVSDLVDGLVALMEGEHIGPFNLGNPGEFTM
LELAEVVKEVIDPSAKIEFRANTADDPHKRKPDISKAKELLNWEPKVPLREGLPLMVNDF
RNRILNEDEGKEN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcataagcagtctagcagaagagatgaagaaatacccaattctcaaataagc
ttaccatactcaccaaagaccctcaaacatccaactagatctctacccagatccattaac
tatctcctcaaagaacaaagacttttattcattcttattggtattctcattggttccact
ttctttatatttcaacctagtctttctctcttaagcacatcttctgaaccacattcttca
attcccagatcatataatgctttaaatcatgaatccttatcaactatttcatcttataat
aatgtaccaatttttaaagggagggtaccagttggggttgggagaaaaaggatgaggatt
gtagtaactggtggggctggttttgttgggagtcatttagtggataagttaattaagaga
ggtgatgatgttattgttattgataatttctttactgggaggaaagaaaatgtgatgcat
cattttgggaatccaagatttgagcttattaggcatgatgttgttgagcctattttgttg
gaagtagatcagatttatcacttggcttgccctgcttctcctgttcactacaagtataat
cctgtcaaaactattaagacaaatgtgatgggcacgcttaacatgttgggccttgcgaag
aggattggtgcgaggttcttgcttaccagtacaagtgaggtttatggtgacccactcgag
catcctcaaaaggaaacatattggggtcatgtgaatccaataggtgttaggagctgctat
gacgagggaaaacggactgctgaaacattgactatggattaccatcgtggtgcaggtgta
gaggtgcgtattgctcggattttcaatacgtatggacctcgcatgtgtctagatgatgga
cgtgttgtcagcaactttgttgcccaggccattcgcaaccaaccgatgacagtatatggt
gatggaaagcaaacacgaagcttccaatatgtctctgatctggttgatggattggtggcc
ctcatggagggtgagcatatcggccctttcaacttaggaaatccgggagaattcaccatg
ttggagcttgctgaggtggttaaagaagtgattgatcccagtgcaaaaatcgagttcaga
gccaacacggccgatgatcctcacaagaggaaaccagatattagcaaagctaaagagctg
ctaaactgggaaccaaaagtacccttgcgagaagggcttcctctcatggtcaatgatttc
cgcaatcgcatattgaatgaagatgaaggaaaagagaattaa

DBGET integrated database retrieval system