KEGG   Nicotiana tabacum (common tobacco): 107761564Help
Entry
107761564         CDS       T04643                                 

Definition
(RefSeq) probable inactive receptor kinase At5g58300
Organism
nta  Nicotiana tabacum (common tobacco)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_8 LRR_4 LRRNT_2 LRR_1 PRIMA1 Tweety CD34_antigen Astacin
Motif
Other DBs
NCBI-GeneID: 107761564
NCBI-ProteinID: XP_016435276
UniProt: A0A1S3X5T2
Position
Un
AA seq 690 aa AA seqDB search
MSCFLQEEPANCVSFSSKSLRRKARSEGLLQLKSCFSMFASQISKNIMKLQYLLAAVAFL
ISLLSNFPHVIADLDSDRQALLEFANSVPHIRKLNWNLTIPICKSWAGITCNKDGTRVIA
IHLPAVGLFGPIPANSIGKLDALKVLSLRANYLNGSLPSDLFSIPSLQSVYLQHNNFSGD
IPVSLSPRLGVLDLSFNSLTGKIPATIKSLSRLSVLNLQFNSLRGEIPSLDTLKLNHLNL
SYNMLNGSVPNSLQKFPLSSFVGNSRLCGTPLTSCSLNSPSPSPAADSLSPPERPKTVNS
KKLSTGTIIAIAVVASSLIFLLVLAISFCCLKKKVSDNTSTIKEKVALANGGRSEKTEDF
GSGVPDAEKNKLVFFEGCTYSFNLEDLLRASAEVLGKGSYGTAYKAVLDEATIVVVKRLR
EVGAAKKEFEQHMEIVGRVGRHPNIVPLRAYYYSKDEKLLVTEYMPAGSLSAALHGNSGI
GRTPLDWDTRLKISLGAAKGIAHIHTEGGVKFTHGNIKSSNILLTRDQDGCISDFGLTPL
MNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPR
WVRSVVREEWTAEVFDVELLKYQNIEEEMVQMLQIGLACVAKVPDMRPSMGEVVRMIEDI
RQPEGETRPSSEDNRSKDSNAQTPDLNLVI
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcttcctccaagaggaaccagctaattgtgtttcattctcctcaaagtcatta
cgcagaaaagcaagaagtgaagggctgctgcaactaaaatcttgctttagcatgtttgcg
agccagatcagtaaaaacataatgaagctccaatatttattggcagctgttgcttttctt
atttccttgctatcaaattttcctcatgttatagctgatcttgattccgatagacaggct
ctactcgagtttgcaaactctgttcctcatataagaaaactcaactggaatttgactatc
cctatctgcaaatcttgggctggtatcacttgcaacaaagatggaaccagagtcattgca
atccatctacctgctgttggactttttggtcctatcccggctaacagtataggaaagcta
gacgctcttaaagtccttagtttaagagccaattatcttaatggaagtcttccttctgat
ctcttttcaattccttccctccaatctgtctaccttcagcataataacttctctggtgat
attcctgtttctttatctcctcgacttggtgtactagatctatcgttcaactctttaact
ggaaaaattcccgccacgatcaagagcttgtcgcgattatctgtgttgaacctacagttc
aattcattgagaggagaaatccccagccttgacaccctcaagttaaaccacttgaatttg
agttacaacatgctaaatggctcagttccgaactccctccaaaagtttccactttcatca
ttcgtgggaaactctcgtttatgtgggacacctctaactagctgttctttgaattctcca
tcaccttctccagcagcagatagcttatctccacctgaaagaccaaagactgtcaactct
aagaaactaagtactggaaccatcattgccatcgcagttgtggcttcttcgttgattttt
ctcctagttttagctatctccttctgctgtttgaaaaagaaagtaagtgacaacactagc
acgattaaagaaaaagtggcactggctaatgggggaaggagcgagaagactgaggacttt
ggaagtggggtgccagatgctgagaagaacaagttggtattctttgaaggttgcacttac
agcttcaatctggaggatcttcttagagcttccgcagaggttcttggtaaagggagttac
ggaacagcttacaaagctgtcttggatgaggcgacgattgtggtggtgaaacggctgagg
gaagtaggtgctgctaaaaaagagtttgaacagcatatggagattgttggaagggttggg
aggcaccctaatattgtgccactccgtgcatattattattccaaggatgagaaacttctt
gttaccgaatacatgcctgctggtagcttgtcagccgccttacatggtaatagcggtatt
ggtagaactccactagactgggatacaagattgaagatatctctaggagcagcgaaagga
attgcccacatccacactgaaggtggagtgaaatttactcatgggaacatcaagtcctcc
aatatacttctcacaagagaccaagatggatgcatttctgattttggcttaacacctcta
atgaactacataccatttaagtatagatgtgctggttaccgcgctccagaagtgattgaa
acgcggaaagggacacaaaaatccgatgtttatagcttcggagtgttgctcctagaaatg
ctgacagccaaatcccctatcccattatcaggacatgatgaggtagttgacttgcctagg
tgggtgcggtcggttgttagagaggaatggactgctgaagttttcgatgtagagctgttg
aaataccagaatattgaagaagagatggtgcagatgcttcagattggacttgcttgtgta
gcaaaggtacctgatatgagacctagtatgggagaagtggttagaatgattgaagatatt
cgacaaccagaaggcgagacaaggccttcctctgaggacaacaggtctaaggattctaat
gcacaaacccctgatctgaacctagtaatttaa

DBGET integrated database retrieval system