KEGG   Nicotiana tabacum (common tobacco): 107762144Help
Entry
107762144         CDS       T04643                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00052  Galactose metabolism
nta00500  Starch and sucrose metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107762144
   00500 Starch and sucrose metabolism
    107762144
Enzymes [BR:nta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107762144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 107762144
NCBI-ProteinID: XP_016435956
UniProt: A0A1S3X7U9
Position
Un
AA seq 573 aa AA seqDB search
MANLRFYLPVLILISIHGYGISLFEAASHEIETSDQIYRTAFHFQPAKYWMNDPNGPMIY
MGIYHFFYQYNPYDAQFGNIVWGHSTSTDLVNWTPQPPALLRSEPYDFKGCFSGSTTILS
GGKPAILYTGVDFSDIQVQNLAVPKNLLDPYLIEWVKSPFNPIITPNSVNKIDGQNFRDP
TTAWLNPTDGYWRMVVGNKKNDTGIGLLYKSKNFIDWIQTEQPLHFLNNSGMLECPDFFP
VSTISQIGLDTSSMGTNVKHVFKASVANSDYYTIGKYDPNKDIFIPDNESLDIGLGFRYD
YGKYYASKTFFDSATNRRILFGWVNESVNNLDDINSIRGWAGLQGIPRRIWLQKSGNQLL
QWPIVEIEKLRMNNPVVEGNTVLMSGSVREISGVTATQADVEISFAAKTLEKAEIWEANW
TNPQKICSIKGATVKGGIGPFGLLVLASDDMQEYTAIFFRIFKGENNNNFIVLMCSDQSR
SSLHLPSSDYDKTTYGAFLNVDPVQEKLSLRTLIDHSIVESFGGEGKACITARVYPTNLA
VDGGTHLYVFNNGSENVDISNLTAWSMKTAQIN
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggccaaccttagattttatcttccagttttaatactaatttcaattcatggctatgga
atttctttatttgaagctgcttctcatgaaatagagacatccgatcaaatatacaggact
gcttttcattttcaacctgccaagtattggatgaacgatcctaatggaccaatgatatac
atgggaatttaccatttcttctaccaatacaatccttacgatgcacaattcggaaacata
gtttggggacattctacatcaactgatctcgtcaactggactcctcagccgccggcacta
ctccgatcagagccttatgattttaaaggctgtttttcaggttctacaacaattctctcc
ggcggaaaaccggcaattctctataccggagtagacttttccgatatccaagttcaaaat
ctagccgtgcccaaaaatttattggacccttaccttatagaatgggtaaaatcacctttt
aatccaataatcacacctaattcagtgaacaaaattgatggtcaaaatttcagagatcca
actactgcttggttaaatcctacagatggttattggagaatggtagttggaaataaaaaa
aatgacacaggaattggtttattatacaaaagcaagaattttattgattggattcaaact
gaacaacctttacattttttaaacaattctggaatgttggaatgtcctgattttttccca
gtttcaacaattagtcaaattggtttagacacttcaagtatgggtacaaatgtgaaacat
gtatttaaagcaagtgtagcaaattctgattactatacaattggaaaatatgatccaaat
aaggatatttttattccagataatgaatccttggatattggattaggctttagatatgat
tatgggaagtattatgcttcaaaaacattttttgatagtgctactaataggaggatttta
tttggatgggttaatgaatcagtaaataatcttgatgatataaatagtattagaggttgg
gctggtcttcaaggaattcctagaagaatttggcttcaaaaatctggaaatcaattgttg
caatggccaattgttgaaattgaaaagcttagaatgaataatccagttgttgaaggtaat
actgtgcttatgtctggatcagtacgtgaaatatccggagtcacagctacacaggcagat
gtagaaatttcttttgcagcgaaaacgttggaaaaagcagagatatgggaagcaaattgg
acaaacccacaaaaaatttgtagcataaaaggtgcaacagttaaaggtggaataggacca
tttggattgttagtcttggcatctgatgacatgcaagaatatactgcaattttcttcaga
attttcaaaggagaaaataacaacaattttatagtgctcatgtgtagtgaccagagcagg
tcttccttgcacttgccttctagtgattatgacaaaactacttatggagccttcttgaat
gtggatcctgttcaagaaaaattgtcgctaaggactttgattgatcactcaatagtggag
agctttggtggagagggaaaagcttgcattacagcaagggtttacccaactaatttagca
gtggatggtggaacacatttgtatgtcttcaacaatggttccgagaatgttgacatctca
aatttgactgcttggagcatgaaaacagctcagatcaattga

DBGET integrated database retrieval system