KEGG   Nicotiana tabacum (common tobacco): 107762521Help
Entry
107762521         CDS       T04643                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta03040  Spliceosome
nta04141  Protein processing in endoplasmic reticulum
nta04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nta00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107762521
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107762521
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107762521
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nta01009]
    107762521
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nta03041]
    107762521
   03009 Ribosome biogenesis [BR:nta03009]
    107762521
   03110 Chaperones and folding catalysts [BR:nta03110]
    107762521
   04131 Membrane trafficking [BR:nta04131]
    107762521
   03051 Proteasome [BR:nta03051]
    107762521
   03029 Mitochondrial biogenesis [BR:nta03029]
    107762521
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nta04147]
    107762521
Protein phosphatases and associated proteins [BR:nta01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107762521
Spliceosome [BR:nta03041]
 Complex B
  Other components
   Prp19 complex
    107762521
 Complex C
   Prp19-CDC5 complex
    107762521
Ribosome biogenesis [BR:nta03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107762521
Chaperones and folding catalysts [BR:nta03110]
 Heat shock proteins
  HSP70 / DNAK
   107762521
Membrane trafficking [BR:nta04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107762521
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107762521
Proteasome [BR:nta03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107762521
Mitochondrial biogenesis [BR:nta03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107762521
Exosome [BR:nta04147]
 Exosomal proteins
  Proteins found in most exosomes
   107762521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 107762521
NCBI-ProteinID: XP_016436366
UniProt: A0A1S3X8Z6
Position
Un
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA
EEISSMVLVKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGIISGLNVMRIINEP
TAAAIAYGLDKKAGSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD
NRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSGVHDIVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNERVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKK
KVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDEAISWLDGNQLAEADEFED
KMKELESICNPIIAKMYQGAGPDMAGGMDEDGPSAGASGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaaaggtgaaggaccggcgatcggaattgatttagggacgacgtactcgtgt
gttggtgtatggcagcatgatcgtgtagagatcatagcgaatgatcaaggaaacagaacg
acgccgtcttatgttgcttttactgatacggaacggttgatcggtgatgctgctaagaat
caagtcgccatgaatcctactaacactgtatttgatgccaagcgattgattggtaggaga
tttagtgacccttcagtacaaagcgacatgaagctgtggccttttaaggtcattcctggc
cctgctgataagcccatgattgttgtcaactacaaaggcgaagagaagcaattttctgct
gaagaaatctcctctatggttcttgttaagatgaaggaaatagcagaggcctttcttgga
acaacaataaagaatgctgttgttactgtccccgcttatttcaacgactctcaacgtcag
gctactaaggatgctggaattatttctggcctcaatgttatgcgtattatcaacgagcct
actgctgctgcaattgcttacgggcttgacaagaaagcaggcagttcgggggagaagaat
gtgcttatttttgacttaggtggtggtacatttgatgtctcacttcttactatcgaagaa
gggatttttgaagtgaagtctactgctggtgatacgcatcttggtggggaggattttgat
aataggatggtgaatcatttcgttcaggaattcaagaggaagcacaaaaaggatatcagt
ggaaatcctagagctcttaggaggcttagaactgcttgtgaaagggctaaaagaacactc
tcgtcgacggctcagactactattgaaatcgattctctttacgagggcattgatttctat
acgacgattactcgtgctcggtttgaggagcttaacatggatcttttcagaaaatgtatg
gagcctgttgaaaagtgtttgcgggatgccaaaatggataaaagcggcgttcatgatatt
gttcttgttggtggctctactagaattccaaaggtgcaacaattattgcaggatttcttt
aacgggaaggaactttgcaagagtatcaaccccgacgaagctgtagcctatggtgctgct
gttcaagctgcaatcttgagtggtgaaggaaatgaaagagttcaggacctgttgctgttg
gatgtcactccgctttcgcttggtctcgagactgctggaggtgttatgactgtcttgatt
ccaagaaacaccacaattccaactaagaaagagcaggtgttttctacgtattcggataac
caacccggagtcttgattcaggtgtacgagggtgagagggcaagaacaagagacaacaac
ttgttgggtaaatttgagctctccggtatacctcctgctcctaggggtgtacctcagatc
acagtctgctttgatattgacgcgaatggtatattgaacgtctctgctgaggataaaacc
accggacagaagaacaagatcacaattaccaatgacaagggtaggctatcgaaggaagaa
atcgagaagatggtgcaagaagccgagaagtacaaggcggaggatgaggaacacaagaag
aaggtagaggcgaagaacgcgctagagaactatgcctacaacatgaggaacactattaag
gatgaaaagattggttctaaactcagtccagatgacaagaagaagattgaggatgctatt
gatgaggcgatttcgtggctcgacggtaaccagctagcggaggctgatgagtttgaggac
aagatgaaggagcttgagagcatatgcaaccccattattgcaaagatgtaccaaggtgct
ggtcctgatatggctggtggcatggatgaagatggcccttctgctggtgcaagtggtgca
ggtcctaagattgaggaagttgattaa

DBGET integrated database retrieval system