KEGG   Nicotiana tabacum (common tobacco): 107763885Help
Entry
107763885         CDS       T04643                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00480  Glutathione metabolism
nta00590  Arachidonic acid metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107763885
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107763885
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107763885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 107763885
NCBI-ProteinID: XP_016437880
UniProt: A0A1S3XD62
Position
Un
AA seq 234 aa AA seqDB search
MASFAVFSPICPVLSQAKQKLKCNSSLFSSYKPTLSSTKSSFLQYGFSLPTSKFSGSPLK
SKVMGTISARAATEKTIHDFTVKDIDGKDVPLSKFKGNVLLIVNVASRCGLTTSNYTELS
QVYEKYKTKGLEILAFPCNQFGAQEPGSNPEIKQFACTRFKAEFPIFDKVDVNGPNTAPV
YQFLKSSAGGFLGDLVKWNFEKFLVDKNGKVVERYPPTTSPIQIEKDIQKLLAA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctttgcagtattttcaccaatatgtcctgttttgtctcaagccaaacagaaa
cttaagtgcaactcttctcttttttcttcttataaacccactttaagctctactaaatct
tcatttttacagtatggtttcagtttaccaacctccaaattttctgggtctccattaaag
tctaaggttatgggcacaatctctgctagagctgctactgagaaaactattcatgacttc
actgttaaggatattgatgggaaagatgtcccacttagcaaatttaagggaaatgttctt
ctaattgttaatgttgcttccagatgtggcttgacgacatcaaattacacagagctctct
caggtgtacgagaagtataaaactaaaggacttgagattcttgcttttccatgtaatcaa
tttggggctcaagagccaggatctaatccagagattaaacagtttgcttgcactcggttt
aaagctgaattcccaatatttgacaaggtcgacgtgaatggtcctaacacagcaccagtt
taccagttcctaaaatcaagtgcaggaggatttttaggtgatctggttaagtggaatttt
gagaagtttcttgtggacaaaaatggtaaagttgttgagaggtatccaccaacaacgtca
cctatccaaatagagaaggatattcagaaacttttggcagcataa

DBGET integrated database retrieval system