KEGG   Nicotiana tabacum (common tobacco): 107765750Help
Entry
107765750         CDS       T04643                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase-like
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
nta  Nicotiana tabacum (common tobacco)
Brite
KEGG Orthology (KO) [BR:nta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107765750
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     107765750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavodoxin_1
Motif
Other DBs
NCBI-GeneID: 107765750
NCBI-ProteinID: XP_016439921
UniProt: A0A1S3XJ24
Position
Un
AA seq 413 aa AA seqDB search
MESSSELVRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVLFLKRSSDRSKEVKPIVFPK
SLHVEPEEEIELEPGKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAA
DDDLYEEKLKKETVAFFMVATYGDGEPTDNAARFYKWFTEGQERGTWLQHLTYGVFGLGN
RQYEHFNKIGKVIDEQLSEQGAKRIVPVGLGDDDQCIEDDFAAWREQLWPELDQILRDED
DANSAATPYTAAIPEYRLVIHDTAASHDDKHASMANGNTFLQERAALKEDGAQLGPALLF
FGCRNRRMDFIYEEELQSFVDQGVISELIIAFSREGPQKEYVQHKMLEKASHVWSLISQE
GYLYVCGDAKGMARDVHRTLHTIVQEQDKVDSTKAEAIVKKLQMDGRYLRDVW
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgagttcggagctggtgagatcgattgaatcggcgttaggagtgtcgttgggg
agcgatacggtgttggtgctactgacgacgtcgtttgctgtcatcgttgggttagtggtg
ttgtttttgaagagatcaagtgatcggagtaaagaagtgaagcctatcgtgttccccaag
tccttacacgtggagccggaggaggagattgagctggaacctggaaaagttaaggtcacc
gtatttttcggtactcaaactggtactgctgagggttttgccaaggctttatcagaggag
ataaaagcaagatatgagaaggcagtagtaaaagttgtggacatggatgattatgctgcc
gatgatgatctgtatgaggagaaactgaagaaagaaacagtagcatttttcatggtggca
acctatggggatggcgagcccactgataatgctgcaaggttttacaagtggttcactgag
ggacaagaacggggcacgtggctgcagcaccttacctatggagtttttggcttgggtaat
cgccaatatgaacattttaacaagattgggaaggtgatagatgaacaattaagtgaacaa
ggtgcaaaacgtattgtgcctgttggccttggtgatgatgatcagtgcattgaagatgat
tttgctgcctggcgagaacaactgtggcctgagttagatcaaatacttagagatgaggat
gatgcaaattctgcagccactccatatacagctgcaattcctgaatatcgtttggttatc
catgataccgctgcgagtcatgatgataagcatgccagcatggctaatggaaataccttc
ctgcaggaaagagcagcattgaaggaagatggggctcaacttggtcctgctttgttgttt
tttggttgtaggaatcgtagaatggattttatttatgaggaggagcttcagagttttgtg
gatcaaggtgtaatatcagagctgattattgcattttcaagggaaggaccccagaaagag
tatgttcaacataaaatgctggaaaaggcttcccatgtttggagtttaatctcccaggag
ggatatctatatgtatgtggggatgcgaaagggatggccagggatgtacatcgtacgctc
cataccatagtccaggagcaggataaggtcgactcaaccaaagctgaggctattgtgaag
aaactccaaatggatggaagatatctcagggatgtgtggtga

DBGET integrated database retrieval system