KEGG   Nicotiana tabacum (common tobacco): 107767858Help
Entry
107767858         CDS       T04643                                 

Definition
(RefSeq) homeobox-leucine zipper protein ATHB-12-like
Organism
nta  Nicotiana tabacum (common tobacco)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain HALZ Homeobox_KN Acetyltransf_11
Motif
Other DBs
NCBI-GeneID: 107767858
NCBI-ProteinID: XP_016442443
UniProt: A0A1S3XR70
Position
Un
AA seq 225 aa AA seqDB search
MSVGERHPTNSNMWSQSSLLGKDLNLHSMSSIKNCKDNMRRRFNDEQIRSLEHMFETEAR
PELRTKQQLAKSLGLQPRQVAIWFQNKRARSKSKQLEMEYRMLKISYDNLGSKYEMLKKE
NESLLIQLQRLRKLTEKGGNEEIQNEGNKLETEVIKSEFIPETCSPEFGLPLGEDSREID
YLGPESDILNMAQIADGLSEIENECNFESRTFLDDSDCRSPLWEF
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaggagaaaggcatccaacaaactccaacatgtggagtcaatcatccttatta
ggaaaggatctaaatctacactctatgtcaagtattaagaattgcaaggacaacatgcga
agaagattcaacgacgagcaaattcggtcattagaacacatgtttgagacagaggcaagg
cctgaactgagaacaaaacagcagttggctaaaagcttaggcctacagccgcgccaagtt
gctatatggtttcagaacaagagagctagatcaaagtccaagcaacttgagatggagtat
agaatgcttaaaatcagttatgataaccttggttcaaagtatgaaatgctcaaaaaagag
aatgaatccctcctcatccagttgcagagacttagaaagttaactgaaaagggtggcaat
gaagagattcagaatgaaggcaataaattagaaacagaggtgatcaagtcagagttcata
ccagaaacttgcagccctgaatttggcttacctttaggtgaagacagtagggaaattgac
tacttggggccagaatctgatattctaaacatggctcaaatagctgatggtttatcagaa
atcgagaacgagtgtaactttgagtcaagaacatttcttgatgattctgattgtagatca
cccttgtgggagttttag

DBGET integrated database retrieval system