KEGG   Nicotiana tabacum (common tobacco): 107768483Help
Entry
107768483         CDS       T04643                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK9
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
nta  Nicotiana tabacum (common tobacco)
Brite
KEGG Orthology (KO) [BR:nta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nta01001]
    107768483
   01009 Protein phosphatases and associated proteins [BR:nta01009]
    107768483
Enzymes [BR:nta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107768483
Protein kinases [BR:nta01001]
 Serine/threonine kinases: Other
  Wnk family
   107768483
Protein phosphatases and associated proteins [BR:nta01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107768483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 107768483
NCBI-ProteinID: XP_016443096
UniProt: A0A1S3XT21
Position
Un
AA seq 753 aa AA seqDB search
MNGLSHTEPDFSEFVEVDPTGRYGRYSEILGKGASKTVYRAFDEYEGIEVAWNQVKLYDF
LQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDPSNRNINFVTEMFTSGTLRQYRLKHK
RVNIRAVKRWCRQILNGLLYLHSHDPPVIHRDLKCDNIFINGNQGEVKIGDLGLAAILRK
SHAAHCVGTPEFMAPEVYEEEYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVIS
GKKPDSLYKVKDPEIRQFVEKCLATVSLRLSARELLDDPFLRIDDIESDLRPIESKRELD
YMNPLLRQPILGLDYEGKSFGNGSYSGYCNDYGFDDLNEWASDPNEYEQTGIELFEYNED
EHDEHSADLDITIKGKRREDGSIFLRLRIADKEGRIRNIYFPFDIEYDTALTVATEMVSE
LDITDQDVTKIADMIDGEISKLEPDWRPGPGIEETPRFANSNLCRNCSSNNSSIGSFMNF
LSKNPASQSLQCNGCAATHGRFEEVTYHSNSPRPIISTCSDDPASSSHINGVHYNLFKMN
GFHHTEMWDRHESFECSSVGSEESHSLEDGEKLYPDPSTEDQKEAGSKSDLTSGAKILGR
SLSNPRSLGEIPASSYETSEYEHEIEREMRWLKANYQIQLRELKDQHLGLPPKASKPPTG
SSKRKKKAKNRKSCLETLLKSSDCDKNLSSESNGLVNKSCPSSVTPRARICEAIKGSPNV
KDMVSTAKSFFTKTLLPNSLHRTTSLPVDAVNI
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtctttcacatacagaaccagatttttctgaatttgttgaagttgatccaact
ggtagatatggcagatacagtgaaattcttggaaaaggagcttctaagactgtttataga
gcatttgatgaatatgaaggtattgaagttgcttggaaccaagtcaagctctatgatttc
ttacaaagtcctgaagatcttgagaggctctactgtgaaattcatttgctcaagactttg
aagcacaaaaatattatgaagttctatacttcttgggtagatccttctaataggaacatc
aattttgttactgaaatgttcacttctggaactcttagacagtataggctgaaacataaa
agagtcaacattagagcagtaaagcggtggtgcagacagatcttgaatggacttctctat
cttcatagtcatgatccccctgtaatccatagagatcttaagtgtgataacatttttatc
aatggaaaccaaggggaagttaaaattggagatcttgggcttgctgctattctgcgaaaa
tcgcatgctgctcattgtgtcggaacgcctgagttcatggcaccagaagtatatgaggag
gaatacaatgaattagttgacatatattcttttgggatgtgcatattagaaatggttact
tttgaatacccttatagtgagtgcactcatcctgctcagatttacaagaaagtgatctct
gggaaaaaaccagactcgttgtacaaagtgaaggatcctgagatacgtcaatttgttgaa
aaatgcttggctaccgtgtctctaaggctctcagcaagagagcttctggatgaccctttt
ctccgaattgatgatattgaatcggatttaagacctatagagtccaagagagaactagat
tatatgaacccgctactaaggcagcctattctaggactagattatgaaggaaaatctttt
ggtaatggctcctatagtggatactgcaatgattatggtttcgatgatctaaatgaatgg
gcatctgatccaaatgaatatgagcaaactggaattgaacttttcgagtataatgaggat
gagcacgacgaacattctgcagatttggatataactattaaagggaagagaagagaagat
ggtagcatatttttaagactcagaattgcagacaaagaaggccgtatcaggaatatttat
ttcccatttgatattgaatatgataccgcattaactgttgcaactgaaatggtgtccgaa
ttggatataactgatcaagatgttacaaaaatagccgatatgattgatggtgagatttcc
aaattagaacccgactggaggccagggccaggaatagaagaaacccctcgctttgcaaat
tctaacttatgtcgtaactgttcatccaacaattcctctattggttcgttcatgaatttc
ctgtccaaaaatccagcttctcagagtttgcagtgcaacggatgtgctgctacacatggt
cgatttgaagaggttacatatcattcaaacagccctcggcctattatttcgacgtgttct
gatgatccagcatcatctagccatattaatggtgttcattacaacttgttcaaaatgaat
ggtttccatcacacagagatgtgggatcggcatgaaagttttgaatgcagttcagtggga
tccgaggagagtcattcccttgaagacggtgagaaattgtatcctgacccttcaacagaa
gatcagaaagaggctggatcaaagagtgacctgacatcaggtgcaaaaattttaggcaga
tcgttgtcaaatccccgttctttaggtgaaattcctgcatcatcatatgaaacttcagag
tatgagcacgaaattgagcgggaaatgagatggctcaaagcaaactaccagatacaactg
agggagctaaaagatcaacacttaggacttccaccgaaagcttcaaaacctcctacaggc
tcctctaaaaggaaaaagaaagcaaagaataggaaatcatgtcttgaaacactactcaaa
tcttccgattgtgataagaacttgagctcagaatcgaatggacttgtcaataaaagctgc
cccagttcggtaaccccaagggcccgaatatgtgaggcgattaaaggttccccaaatgtc
aaggacatggttagtactgcaaagagtttcttcaccaaaacattgcttccaaattcactt
cacagaacaacatccttaccagttgatgctgttaatatatag

DBGET integrated database retrieval system