KEGG   Nicotiana tabacum (common tobacco): 107768688Help
Entry
107768688         CDS       T04643                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00970  Aminoacyl-tRNA biosynthesis
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107768688
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nta03029]
    107768688
Enzymes [BR:nta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     107768688
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     107768688
Mitochondrial biogenesis [BR:nta03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    107768688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_Yqey DUF2009
Motif
Other DBs
NCBI-GeneID: 107768688
NCBI-ProteinID: XP_016443314
UniProt: A0A1S3XTW9
Position
Un
AA seq 125 aa AA seqDB search
MKNEKVTINEIKLTPQELGELIASIKDGTISGKIGKEILFELMAKGGTVKGLIKEKDLVQ
IVDTAEIEKMVDKVIADNPKQLEQYRGGKTKLQGFFAGQVMKESKGKANPKLLNKILLEK
LNATS
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaaaaagtgactatcaatgagattaaacttacccctcaagaacttggggag
ctcatagcttcaattaaagatgggactatcagtggaaagattggaaaggagattctattt
gagctaatggccaagggtggaactgtcaagggactgataaaagaaaaggatttggttcag
attgttgacactgcggagattgagaaaatggtagataaggtgattgcagataatccaaag
cagctagaacaataccgtggtggtaaaactaaattgcaaggtttttttgctggccaggtg
atgaaggaatcgaaaggcaaagcaaatccaaaacttttgaacaaaatccttttagaaaaa
ttaaatgctacaagctga

DBGET integrated database retrieval system