KEGG   Nicotiana tabacum (common tobacco): 107769473
Entry
107769473         CDS       T04643                                 

Gene name
PGAM-I, TOBPGM
Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00010  Glycolysis / Gluconeogenesis
nta00260  Glycine, serine and threonine metabolism
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
nta01200  Carbon metabolism
nta01230  Biosynthesis of amino acids
Module
nta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nta_M00002  Glycolysis, core module involving three-carbon compounds
nta_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107769473 (PGAM-I)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107769473 (PGAM-I)
Enzymes [BR:nta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     107769473 (PGAM-I)
SSDB
Motif
Pfam: Metalloenzyme iPGM_N Alk_phosphatase
Other DBs
NCBI-GeneID: 107769473
NCBI-ProteinID: NP_001311960
UniProt: P35494
Position
Un
AA seq 559 aa
MGSSGDAWKLKDHPKLPKGKTVAVIVLDGWGEAKPNEFNAIHVAETPVMYSLKNGAPEKW
RLIKAHGNAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIYEGEGFKYVK
ECFEKGTLHLIGLLSDGGVHSRLDQVQLLLKGAAKHGAKRIRVHALTDGRDVLDGSSVGF
METLENSLAQLREKGIDAQVASGGGRMYVTMDRYENDWDVVKRGWDAQVLGEAPHKFKDP
VEAVKKLRQEPNANDQYLAPFVIVDDNGKPVAAILDGDAVVTFNFRADRMVMLAKALEYE
NFDKFDRVRVPKIRYAGMLQYHGELQLPSHYLVSPPEIARHSGEYLVRNGVRTFACSETV
KFGHVTFFWNGNRSGYFNEKLEEYVEIPSDSGITFNVKPKMKALEIAERTRDAILSGKFD
QVRVNLPNGDMVGHTGDIKATIEACKSADEAVKMILEAIEQVGGIYLVTADHGNAEDMVK
RNKKGEPALDKNGNIQILTSHTCEPVPIAIGGPGLAPGVRFRQDLPTGGLANVAATFMNL
HGSEAPSDYEPSLIEVVDN
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgggaagttcaggagatgcatggaaattgaaagaccaccctaaacttccaaagggaaag
acagtagctgtgattgttttggatggttggggtgaggctaaacctaatgagtttaatgct
atccatgttgctgaaactcctgttatgtactccctcaaaaatggtgctcctgaaaaatgg
agattgattaaggcacatggtaatgctgtaggactgcctacagaggatgatatgggcaac
agtgaggttggtcacaatgctcttggtgctggaaggatctttgctcaaggtgcaaagctt
gttgatctggcccttgcctctggtaaaatatatgagggagaaggtttcaagtacgttaaa
gaatgttttgaaaaaggaactttgcacctcattggactcttgagtgatggaggtgttcac
tccaggcttgatcaagtgcagttgttgctgaaaggtgctgctaagcatggtgccaaaaga
attcgtgtccatgccctcactgatgggcgtgatgttctagatggttctagtgtgggtttc
atggagactcttgagaattctcttgcacaattacgtgaaaaaggtattgatgcccaggtt
gcatcaggcggaggtcgtatgtatgttaccatggatcgatatgagaatgactgggatgtc
gttaaaagaggttgggatgctcaagttcttggtgaggctccacacaagttcaaggatccc
gttgaagcagttaaaaagttgaggcaggaacccaacgccaatgaccagtacttagcccct
tttgttattgttgacgataatggaaagcccgttgcggctattttagacggtgatgctgtt
gtgactttcaacttcagagcagatcgtatggtcatgcttgcaaaggcccttgaatacgag
aactttgataaatttgatcgtgtacgagtccctaaaatccgttatgctggtatgctccaa
tatcatggtgagttgcagcttccaagccactacctcgtttctcctccagaaattgcacgg
cactctggggagtatctagtgcgcaatggtgttcggacttttgcttgcagtgagactgtt
aaatttggtcatgtcaccttcttttggaatggaaaccgctccgggtattttaacgagaaa
ttggaagagtacgtggaaattccaagtgacagtggaattacatttaacgttaagccaaaa
atgaaggcgctggagattgctgaaaggactagagatgccatccttagcgggaaatttgac
caggtacgtgtgaacctacctaacggtgatatggttggacatactggtgatataaaagca
actattgaagcttgcaagtctgctgatgaggctgtcaagatgatccttgaagctattgaa
caagttggtggaatatatctagttactgccgaccatggaaatgctgaagatatggttaag
agaaataagaagggggagccagctcttgacaagaatgggaatattcagatactcacttct
cacacttgcgaacctgttcctattgcaattggtggtcctggactggcacccggtgtgaga
ttccgccaagatctccctaccggtgggcttgctaacgtcgctgcaacctttatgaatctg
catggctcagaggcaccaagcgattacgagccaagcttgattgaggttgttgacaactag

DBGET integrated database retrieval system