KEGG   Nicotiana tabacum (common tobacco): 107770131Help
Entry
107770131         CDS       T04643                                 

Gene name
vi
Definition
(RefSeq) acid beta-fructofuranosidase AIV-18-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00052  Galactose metabolism
nta00500  Starch and sucrose metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107770131 (vi)
   00500 Starch and sucrose metabolism
    107770131 (vi)
Enzymes [BR:nta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107770131 (vi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 107770131
NCBI-ProteinID: NP_001311983
UniProt: Q8GUA3
Position
Un
AA seq 643 aa AA seqDB search
MATHHSHYDPENSTTHYTVLPDQPESAGSGHRKSLKVVSGILLSSFFLLSLVFVIVNQSS
DLSQKNSHSSETLTPALSRGVSQGVSEKTFRDVSGGSLSYYPWTNAMLTWQRTAYHFQPQ
KNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAISTDLIHWLYLPFALVPDQWYD
INGVWTGSATFLPDGQIMMLYTGDTNDYVQVQNLAYPANLSDPLLIDWVKYRGNPVMVPP
PGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGIAIVYGTSNFTNFKLLDGVLHAVPG
TGMWECVDFYPVSTDEANGLDTSYNGPGIKHVLKASLDDDKHDYYAIGTYDPVKNKWTPD
NPQLDVGIGLRLDYGKYYASKTFYDPKEQRRILWGWIGETDSEAADLLKGWASVQSIPRT
VLYDKETRTHVLQWPVKEIESLRIGDPLVKRVNLQPGSIELVHVDSAAQLDVEASFEVDK
AALEGTIEADVGFNCSTSGGAAKRGILGPFGVVVIADQTLSELTPVYFYIAKGPDGRAET
YFCADETRSSEAPGVAKQVYGSSVPVLDDEQHSMRLLVDHSIVESFAQGGRTVITSRIYP
TKAINGAARLFVFNNATRASVTASLKIWSLESADIRSFPLDQL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaccattcccattatgacccggaaaactccacgacccattacactgtcctg
ccggaccaacccgaatccgccgggtccggtcaccggaaatccctcaaagtcgtctccggc
attcttctctcctccttctttttgctttctttagtctttgtgatcgtcaaccaatcttca
gacttatcacaaaaaaactcccactcgtcggagaccttgacgccggcgttgtcaagaggt
gtatctcagggagtttccgagaagactttcagggatgtgtccggtggaagcctttcgtac
tacccgtggactaatgctatgcttacttggcaaagaactgcttaccattttcaacctcaa
aagaattggatgaacgatcctaatggtccattataccacaaaggatggtaccatcttttt
tatcaatacaatcctgattcagctatttggggaaatatcacatggggccatgcaatatcc
acggacttgatccattggctttacttgcccttcgccttggttcctgatcaatggtacgat
atcaacggtgtctggaccgggtccgcgaccttcctacccgacggtcagatcatgatgtta
tacaccggtgataccaatgattacgtgcaggtgcaaaatcttgcgtaccccgccaactta
tcggatcccctcctcatcgactgggtcaagtaccggggcaacccggtcatggttccacca
cccggcattggtgtcaaggactttagagacccaacgactgcttggaccggaccacaaaac
gggcagtggctgcttaccatcgggtccaagattggtaaaacgggtattgcaattgtttat
ggtacttccaacttcacaaactttaagctattggatggagttttgcatgcggttccgggt
acgggtatgtgggagtgtgtggacttttacccggtatcaaccgatgaggcaaacgggttg
gacacatcatataacgggccaggtataaagcatgtgttaaaagcaagtttagatgacgat
aagcatgattactatgctattgggacatatgacccggtaaagaacaaatggactcctgat
aacccgcaattggatgtgggtatcgggttgagactggactacgggaaatactatgcgtca
aagacattttatgacccgaaggaacaaagaagaatattgtggggatggattggggaaact
gacagtgaagctgctgatctgctgaagggatgggcatctgtacagagtattccaaggact
gtgctttatgataaggagactaggacacatgttcttcagtggccagttaaagaaattgag
agcttaagaattggtgatcctctagtgaaacgggtcaatcttcaaccaggctcaattgag
ctagtccatgttgactcagccgcacagttggatgtagaagcctcatttgaagtggacaaa
gcagcactcgagggaacaattgaagcagatgttggtttcaactgcagtactagtggaggt
gctgctaaaagaggcattttgggaccatttggtgtcgttgtaattgctgatcaaacgctt
tctgagctaactccagtttacttctacattgccaaaggacctgatggccgagctgaaacc
tacttctgtgctgatgaaactagatcctcagaggctcctggagttgctaaacaagtgtat
ggtagttcagtaccagtgttagatgatgaacaacactcaatgagattattggtggaccac
tcaattgtggagagctttgctcaaggaggaagaacagtcataacatcgcgaatttaccca
acaaaggcaatcaatggagcagcacgactgttcgttttcaacaatgccacgagggcaagt
gtgactgcctccctgaagatttggtcactcgaatcagctgatattcgatccttccccttg
gaccagttgtaa

DBGET integrated database retrieval system