KEGG   Nicotiana tabacum (common tobacco): 107772357Help
Entry
107772357         CDS       T04643                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
nta  Nicotiana tabacum (common tobacco)
Brite
KEGG Orthology (KO) [BR:nta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107772357
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     107772357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 NAD_binding_7 K_oxygenase IlvN Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 107772357
NCBI-ProteinID: XP_016447341
UniProt: A0A1S3Y591
Position
Un
AA seq 116 aa AA seqDB search
MSGYSFFQRASRAFNDYPHLPKVLVLFTVSGGGLAAVCHTAYADAGQNDVKKKKVVVLGT
GWAGTSFLKNLKDPSYSVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVKK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggtacagtttctttcagagagcctccagagctttcaatgactaccctcatctc
cctaaagttcttgttcttttcactgttagtggtggaggactagctgcagtatgtcatact
gcatatgctgatgcaggtcagaatgatgttaagaagaagaaagtggtagtgcttggaaca
ggctgggccggaacaagtttccttaagaatttgaaagacccctcatattctgttcaggtc
gtgtctcctcgcaactattttgccttcactcctctgttacctagtgttacctgtggcaca
gttgaagcaaggagcattgtagaaccaattcgtaatattgtcaaaaag

DBGET integrated database retrieval system