KEGG   Nicotiana tabacum (common tobacco): 107772548Help
Entry
107772548         CDS       T04643                                 

Definition
(RefSeq) pyruvate decarboxylase 1-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00010  Glycolysis / Gluconeogenesis
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107772548
Enzymes [BR:nta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     107772548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_M CO_dh
Motif
Other DBs
NCBI-GeneID: 107772548
NCBI-ProteinID: XP_016447534
UniProt: A0A1S3Y5S6
Position
Un
AA seq 220 aa AA seqDB search
AVVNNLHDAHELIDTAISTALKESKPAYISISCNLPGLPHPTFAREPVPFFLSPKASNQL
GLEAAVEAAAEFLNKSVKPVIVGGPKVRVAKAQQAFVELADACGYPIAVMPSGKGLVPEH
HSNFIGTYWGAVSSSFCGEIVESADAYVFVGPIFNDYSSVGYSLLIKKEKLIVVEPNRVT
IGNGPSFGWVFMTDFLSALAKKLKNNSTALENHHRIYVPP
NT seq 661 nt NT seq  +upstreamnt  +downstreamnt
gcagtggtaaataacttgcatgatgcacatgaattgattgatactgcaatttcaactgct
ttgaaggagagcaagccagcttacattagcataagctgcaatttgcctggacttcctcac
cctacctttgctagagaaccggttccattctttctttctccaaaggccagcaatcaacta
ggattagaagcagcagttgaagcagcagctgagttcttgaacaagtctgtaaaaccagtt
attgtgggaggtccaaaagtaagagtggcaaaagcacaacaggcttttgtggaacttgct
gatgcctgtggctacccaatagcagtaatgccatctggcaagggactggtgccagagcac
cactctaatttcattggtacttactggggagcagtgagctctagtttctgtggggagatt
gttgaatctgcggatgcttatgtctttgttggccctatcttcaatgactacagctctgtt
ggatactcgttgctgattaaaaaggagaagttgatcgttgttgaacctaatcgtgtgact
attgggaatggcccctcctttggttgggttttcatgactgatttcttgagtgcattggcc
aaaaagctgaagaacaacagcactgctttggagaatcaccatcgaatttatgtccctcca
g

DBGET integrated database retrieval system