KEGG   Nicotiana tabacum (common tobacco): 107773180Help
Entry
107773180         CDS       T04643                                 

Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial-like
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00020  Citrate cycle (TCA cycle)
nta00640  Propanoate metabolism
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
nta01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107773180
   00640 Propanoate metabolism
    107773180
Enzymes [BR:nta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     107773180
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     107773180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA
Motif
Other DBs
NCBI-GeneID: 107773180
NCBI-ProteinID: XP_016448115
UniProt: A0A1S3Y7E9
Position
Un
AA seq 95 aa AA seqDB search
MSGIVLIGEIGGTAEEDAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA
QDKIKALKEAGVTVCESPAKIGVTMLDVFKQRGLA
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtatagttcttattggtgagatcggtggtactgcagaagaagatgctgcagcc
ttgataaaggaaagtggaactcaaaagcctgttgttgcatttattgctggactaactgct
ccccctggacggcgaatgggtcatgctggagccattgtatctggtggaaagggaacagca
caggacaaaatcaaggctctcaaggaagctggggttacagtatgcgagtctcctgcaaaa
atcggggtcacaatgcttgatgtgttcaaacagaggggtcttgcataa

DBGET integrated database retrieval system