KEGG   Nicotiana tabacum (common tobacco): 107773730Help
Entry
107773730         CDS       T04643                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00052  Galactose metabolism
nta00500  Starch and sucrose metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107773730
   00500 Starch and sucrose metabolism
    107773730
Enzymes [BR:nta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107773730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C SpoOE-like
Motif
Other DBs
NCBI-GeneID: 107773730
NCBI-ProteinID: XP_016448640
UniProt: A0A1S3Y905
Position
Un
AA seq 584 aa AA seqDB search
MEFFKKSSSLWDTFAISLVSFIVVFPNINGVFGSHKVYIDLQSSSAVNVKNVHRTGFHFQ
PPKHWINDPNAPMYYNGIYHLFYQYNPKGSVWGNIVWAHSVSKDLINWIHLEPAIYPSKK
FDKYGTWSGSATILPSNKPIILYTGLVDSNKTQVQNYAVPANLSDPYLREWIKPDNNPLI
VPDISINKTQFRDPTTAWMGQDGHWRILVGSLRKQRGLAILYKSRDFIRWVKAKHPLHSS
ANTGNWECPDFYPVSLQSTKGLDASYYGENTKYVLKNSLDVTRFEYYTIGTYDSKKDRYI
PDNTFIDGWKGLRLDYGNFYASKSFYDPVKNRRIVWGWTNESDILPDDDIKKGWAGIQAI
PRKVWLDPSGKQLVQWPVEELETLRKQMVQLSNKKLNKGEMVEVKGITPAQADVEVTFSF
SSLDKAEQFNPKWADLYAQDVCAIKGSTIQGGLGPFGLVTLASKNLEEYTPVFFRVFKAQ
RNYKVLMCSDARRSTLKHSEAMYKPSFAGYVDVDLVGKKLSLRSLIDNSVVESFGAGGKT
CITSRVYPTLAIHDNTHLFAFNNGTEKIKIETLNAWSMGTSNIT
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggagttttttaagaaaagctcttctctttgggatacttttgcaatttccttagttagt
ttcattgtagtttttccgaatattaatggagtgtttggttcccacaaagtttatatagac
ttacaatcttcaagtgctgttaatgtcaaaaatgtccacagaactggtttccattttcaa
ccaccaaagcattggatcaatgaccctaatgctccaatgtattacaatggaatctatcat
ctattctatcaatacaatccaaaaggatcagtttggggtaatattgtttgggctcattca
gtttcaaaagatttgattaattggattcatttagagcctgcaatttatccatctaaaaaa
tttgacaaatatggaacatggtctggatcagcaaccattctccctagtaacaagcccatt
attttatatactggactagtagattccaataaaacccaagtccaaaattacgccgtcccc
gccaacttatccgatccatatctccgtgaatggatcaagcccgataacaacccgttaatc
gtccccgatatcagtatcaacaagacccaatttcgcgacccgacaacagcttggatgggc
caagatggtcattggagaattttggtagggagtttgagaaaacaaaggggattagcaata
ttgtataagagtagagactttataagatgggttaaggctaaacacccactccattcatct
gctaatactggaaattgggaatgtcctgatttttatcctgtatcattgcaaagtactaaa
ggtttagatgcatcatactatggtgagaatactaaatatgtccttaaaaatagtcttgat
gttactaggtttgagtactacactattggtacgtacgacagtaaaaaagataggtacatt
ccagataacacttttatcgatggttggaagggattgagactcgactatggcaatttttat
gcatctaaatcgttctatgaccctgtcaagaatcgaagaatcgtatggggttggactaat
gaatcggatattttacccgacgatgatattaagaaaggatgggctggaattcaagctatt
ccgcgcaaagtatggctcgaccctagtggtaaacagttggttcaatggcccgttgaagaa
ttagaaaccttaagaaaacaaatggtccaattgagcaacaagaagttgaacaaaggggag
atggttgaagtcaaaggaatcacacctgcacaggctgatgttgaagtaacattctctttt
tcaagcttggacaaggcagagcaatttaatcctaaatgggccgacctttatgcccaagat
gtttgtgctattaagggttcgactattcaaggtgggcttgggccatttgggcttgtcaca
ttagcttctaaaaacttggaagaatacacacctgttttcttcagagttttcaaggcccaa
agaaattataaagttctcatgtgctcagatgctagaaggtctacccttaagcatagtgaa
gcaatgtacaaaccgtcatttgctggatatgtggatgttgatttagtaggcaagaagcta
tctcttaggagcttgattgataactcagtagtggaaagttttggtgctggtgggaaaaca
tgcataacatcaagggtttatccaacattagcaattcatgataatacacatttatttgct
ttcaataatggcacagagaaaatcaagattgaaactctgaatgcttggagtatgggtaca
tctaatataacctaa

DBGET integrated database retrieval system