KEGG   Nicotiana tabacum (common tobacco): 107777104Help
Entry
107777104         CDS       T04643                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00511  Other glycan degradation
nta00600  Sphingolipid metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107777104
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107777104
Enzymes [BR:nta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     107777104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-GeneID: 107777104
NCBI-ProteinID: XP_016452582
UniProt: A0A1S3YKV0
Position
Un
AA seq 781 aa AA seqDB search
MSIWSSSYRKASDHGISSWGWNLSGQHSTYHALFPRAWTVYDGEPDPELKVSCRQISPFI
PHDYRESSLPTSVFVYTLVNTGKERAQVSLLLTWANSIGGVSHLSGDHANEPFIGEDGVS
GVLLHHKTKENPPVTFAVAACETQNVSVTVLPCFGMSEGSCVTAKDMWGKMVEDGHFDRE
NFSKGPSMPSSPGETHCAAVSATAWVEPHGKCTVAFAVAWSSPQVKFMKGKSYYRRYTRF
YGTSERAAVDLVHHSLTNYKLWEEEIEKWQNPILNDVRLPEWYKFTLFNELYFLVAGGTL
WIDSGVPSSDSVSTRITRPSNEVKVTKVKSNYKNGVQVEQTAYNGYGEGNHFSSSDKISE
SIITGSDDVGRFLYLEGVEYIMWCTYDVHFYASFALLALFPKIELSIQREFAKAVLCEDG
RKVKFLAEGNWGIRKARGAIPHDLGMHDPWHEMNAYNIHDTSKWKDLNPKFVLQVYRDFA
ATGDFSFATDVWPSVCAAIEYMDQFDRDNDGLIENDGFPDQTYDTWTVHGISAYCGGLWL
AALQAAAAMAMHVGDYAFAEKCKGRLIKAKTVFEAKLWNGSYFNYDSGSSSNSKSIQADQ
LAGQWYMASSGLPDLFDGVKIKSTLQKIYDFNVMKVRGGRMGAVNGMHPNGKVDETCMQS
REIWTGVTYGLAATMLHAGMEEQAFTTAEGIFIAGWSEDGFGYSFQTPEGWTMDGHFRSL
IYMRPLSIWGMQWALSMPKTILDAPKINIMDRIQVSPYTPQETGVRKIVEKAKCSIFRCS
C
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgtctatatggtcttcctcttacaggaaagcaagtgatcatggtatatcgtcgtggggc
tggaatctgagtggacagcattctacatatcatgcactctttcctagggcttggacagta
tatgatggtgaaccagacccagaactgaaagtttcttgtcggcaaatatcaccgttcatc
ccacatgactacagagagagcagccttcctacatctgtttttgtttacactttggtgaac
actgggaaggaaagggcacaagttagccttcttcttacatgggcgaattcaattggaggt
gtctcacacctatcaggagatcacgcgaacgaaccatttataggtgaagatggagtctct
ggcgtactcctacatcacaagacaaaagaaaatcctcctgttactttcgctgtagctgca
tgcgaaactcagaatgtcagcgttactgttttaccctgtttcggcatgtctgagggaagc
tgtgtaacagcaaaggatatgtggggtaaaatggttgaggatgggcattttgatcgagag
aacttcagcaaaggaccaagcatgccatcatcacctggggagacacattgtgctgcagtt
tctgcaaccgcatgggttgaaccacatggaaaatgtaccgtggcatttgctgttgcttgg
tcatctcctcaagttaaattcatgaaaggaaagtcatattataggaggtacacacggttc
tatggaacttctgaaagggctgctgtagatttggttcatcattctttgacaaattataag
ctgtgggaagaagaaattgagaaatggcagaatcctatccttaatgatgttaggctacca
gaatggtacaagtttacactgtttaacgagctgtattttctggtggctggtggaacattg
tggattgactctggtgttccttcttcagactcagttagtaccagaataacgagaccgagc
aatgaagtcaaagtaactaaagtcaaatcgaattataaaaatggtgtacaagtggaacag
acggcatataatggttatggggaaggcaaccatttctcaagttctgataagatttcagaa
tcaattattactggcagtgatgatgtgggtaggtttctatacttggaaggtgtagaatat
attatgtggtgtacatatgatgtgcacttctatgcctcttttgcacttcttgctttattt
cctaaaattgagctcagcatccagcgggagtttgccaaagcagtcttgtgtgaagatgga
agaaaagtgaagtttctggcagagggtaattggggaatacggaaggcgaggggggctatt
cctcacgatcttggaatgcatgatccttggcacgaaatgaatgcctataacatacatgat
actagtaaatggaaggatctaaatccgaaatttgtgcttcaggtctatagggactttgct
gcaacgggagatttctcctttgctacagatgtctggccttctgtatgtgctgcaattgaa
tatatggatcaatttgatcgtgacaatgatggcctaattgaaaacgatggtttccctgat
caaacgtatgatacatggacggttcatggaataagtgcttactgtggtggtttatggcta
gctgcacttcaagctgcagctgcaatggccatgcacgtgggtgactacgcctttgcagaa
aaatgcaaaggcagattgataaaagccaagacagtgtttgaggcaaaattgtggaacggc
tcatattttaactatgacagtggatctagtagtaacagtaagtcgattcaggccgatcag
cttgctggacagtggtacatggcatcatccggcttgcctgatctcttcgatggcgtaaag
atcaagagtactcttcaaaaaatttatgacttcaatgtcatgaaagttcgtggtggcaga
atgggtgcagtaaatggaatgcatccaaatggaaaggtggatgagacttgcatgcaatcc
cgcgagatatggactggtgtcacgtatggtttggctgccaccatgcttcatgctggtatg
gaggagcaggcgttcactacagctgaaggcatattcattgcaggctggtcagaggatggc
tttggatactcatttcaaacgcctgaaggttggaccatggatggacattttcgatctctg
atatatatgaggcctctctcaatttggggcatgcagtgggcgttatcaatgcctaagaca
atccttgatgcccctaagatcaatataatggacagaattcaagtgtccccctatactcct
caggagacgggcgtccgcaaaatagtcgaaaaagcaaaatgttctatctttcgctgttct
tgctaa

DBGET integrated database retrieval system