KEGG   Nicotiana tabacum (common tobacco): 107779493Help
Entry
107779493         CDS       T04643                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, mitochondrial-like
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00250  Alanine, aspartate and glutamate metabolism
nta00330  Arginine and proline metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107779493
   00330 Arginine and proline metabolism
    107779493
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     107779493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107779493
NCBI-ProteinID: XP_016455426
UniProt: A0A1S3YT57
Position
Un
AA seq 549 aa AA seqDB search
MYRVAAYRQLKIRVSWISSFNSTRSNHTLPFATVKAEEISGSQPAEVHNLVQGKWTGSSS
WNTILDPLNGQPFIKVAEVDESELQPFVESLSKCPKHGLHNPFKAPERYLMLGDVSTKAA
HMLGLPEVSDFFAKLIQRVSPKSYQQAHGEVFVTQKFLENFCGDQVRFLARSFAVPGNHL
GQQSHGFRWPYGPVAVIAPFNFPLEIPVLQMMGALYMGNKPVLKVDSKVCVVMEQFLRLL
HDCGLPADNVDFINSDGKTMNKLLIEGKPRMTLFTGSSRVAEKLADDLSGRVKLEDAGFD
WKILGPDVHEVDYVAWVCDQDAYACSGQKCSAQSILFMHENWGRSSLLDKMTELAARRKL
DDLTIGPVLTVTTEAMLDHAKKLLQIPGSRLLFGGEALQNHSIPAIYGAIKPTAIFIPLE
EILKKQHYHLVTKEIFGPFQVVTEYKDNQLPLVLNALEKMHAHLTAAVVSNDILFLQEVI
GNSVNGTTYAGLRARTTGAPQNHWFGPAGDPRGAGIGTPEAIKLVWSCHREVIYDVGPVP
LGWKTPAST
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgagtagccgcatacaggcagttgaagattagagtttcttggatcagttcattc
aattctaccagatcaaatcatactttgccctttgctacggtaaaagctgaagaaatatca
ggctctcaacctgctgaagtccacaacttggtgcaggggaagtggacaggatcttctagt
tggaatacaatattggatcccttgaatgggcaaccattcattaaagttgcagaagtagat
gaatcagaattgcagccatttgtggagagcttgtccaagtgcccgaaacatggtctacat
aatccattcaaagcaccagaaaggtacctaatgcttggagacgtatctacaaaagcagct
catatgcttggcttgcctgaggtttctgacttctttgctaagctaatacaacgggtgtct
cctaagagttaccaacaagctcatggtgaagtttttgtcacacagaaatttctggaaaat
ttctgtggtgatcaggttcgctttctagctaggtcttttgcagtaccaggaaatcatctg
gggcagcagagccatggttttcgctggccttatggacctgtggcggttattgctcccttt
aattttcccttggagattcctgtacttcagatgatgggagcgttatatatggggaataag
cctgtccttaaagttgatagcaaggtatgtgttgttatggaacaatttcttcgactgctt
catgattgtgggttacctgcggataacgtggatttcataaattcagatggaaagacgatg
aacaagctactcattgagggaaaaccgcgcatgactctcttcacaggtagctcaagagtg
gcagagaagttagctgatgacctaagcggtcgagtcaaactagaagatgctggatttgac
tggaagatccttgggcccgatgtccatgaggtggattacgttgcatgggtttgtgatcaa
gatgcatatgcatgtagtggtcagaagtgttcagctcaatcaatattgttcatgcatgag
aattggggtagaagctctctcttagacaaaatgaccgagcttgctgcaagaagaaagttg
gatgatttaactattggtcctgtccttacggttacaactgaagcaatgctagaccatgcg
aagaaattacttcagatacctggatcaagactgctctttggtggtgaagccttacaaaac
cattctatccctgcaatttatggagccattaaacccactgctattttcataccacttgaa
gaaatactcaaaaaacaacattatcatctcgtgaccaaagagattttcgggccattccag
gttgttaccgagtacaaagataatcagcttccgctggttttgaacgcccttgaaaagatg
catgcacatttaacagctgctgtggtttcaaacgacatactgttcctgcaagaagtaatt
ggaaattcagttaatggaactacttatgctggattgagagcaagaacaacaggggctcca
cagaatcactggtttggtccagctggggacccaagaggagcaggaataggtactccagaa
gctataaaacttgtatggtcttgccacagagaagtcatatatgatgttggtcccgtgcca
ctcggatggaaaactccagcatctacttga

DBGET integrated database retrieval system