KEGG   Nicotiana tabacum (common tobacco): 107780051Help
Entry
107780051         CDS       T04643                                 

Gene name
npp4
Definition
(RefSeq) serine/threonine-protein phosphatase PP2A-2 catalytic subunit
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta03015  mRNA surveillance pathway
nta04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:nta00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107780051 (npp4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other eukaryotes
    107780051 (npp4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:nta01009]
    107780051 (npp4)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nta03036]
    107780051 (npp4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nta04147]
    107780051 (npp4)
Enzymes [BR:nta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107780051 (npp4)
Protein phosphatases and associated proteins [BR:nta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     107780051 (npp4)
Chromosome and associated proteins [BR:nta03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107780051 (npp4)
Exosome [BR:nta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107780051 (npp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos
Motif
Other DBs
NCBI-GeneID: 107780051
NCBI-ProteinID: NP_001312224
UniProt: O04859
Position
Un
AA seq 302 aa AA seqDB search
MPSHGDRQIAQLMECKPLSEAEVKTLCDQAGYTVRMNVQPVKCPVTVCGDIHDSFYDLIE
LFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVY
GFYDECLRKYGNANIWKYFTDLFDYLPLTALIESQIFCLHGGLSPSLDTLDNIRALDRIQ
EVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLTLISRAHQLVMDG
FNWCQDKNVVTVFSPPNYCYRCGNMAAILEIGENLEQNFLQFDPAPRQIEPDTTRKTPDY
FL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgcatggagatcggcaaatcgcacaattgatggagtgcaagccgctatcagaa
gcggaggtgaaaactctgtgtgatcaagcaggctatactgtgagaatgaatgttcagccg
gtgaaatgtccggtgactgtttgcggcgatattcatgacagtttttacgatctcattgag
ctctttcggattggcggcaacgctcctgatactaattatctcttcatgggcgattatgtt
gaccgtggatactattcggtggagactgtcacacttttggttgctctcaaagtccgttat
agagatagaatcacaattcttaggggaaatcatgaaagccggcaaatcactcaagtgtat
ggtttttatgatgaatgcttgaggaaatatggcaatgcgaacatttggaagtatttcact
gatctttttgattatctaccactgacagcacttatagagagtcagatattctgtttgcat
ggaggactctcgccttctctggatacactggataatatccgagcgctggaccgcatacaa
gaggttccacatgaagggccaatgtgtgatctcttgtggtctgatccagatgatcggtgt
ggttggggaatatcacctcgaggggctggttacacctttggacaggatatagcatctcaa
ttcaatcacaccaatggtctcactctgatttctagagctcatcagctagtcatggacggt
tttaattggtgtcaggataagaatgttgtgacagtatttagtcctccaaactattgttac
cggtgtggtaatatggctgccatcctagaaataggcgaaaacctggagcagaatttcctt
cagtttgacccagctcctcggcagatagagcctgacaccacgaggaagactccagattac
tttttgtga

DBGET integrated database retrieval system