KEGG   Nicotiana tabacum (common tobacco): 107783884Help
Entry
107783884         CDS       T04643                                 

Gene name
eIF-4A-10, eIF-4A-13
Definition
(RefSeq) eukaryotic initiation factor 4A-10
  KO
K03257  translation initiation factor 4A
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta03013  RNA transport
Brite
KEGG Orthology (KO) [BR:nta00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    107783884 (eIF-4A-10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nta03019]
    107783884 (eIF-4A-10)
   03012 Translation factors [BR:nta03012]
    107783884 (eIF-4A-10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nta04147]
    107783884 (eIF-4A-10)
Messenger RNA biogenesis [BR:nta03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107783884 (eIF-4A-10)
   mRNA cycle factors
    Stress granule specific factors
     107783884 (eIF-4A-10)
Translation factors [BR:nta03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    107783884 (eIF-4A-10)
Exosome [BR:nta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107783884 (eIF-4A-10)
  Exosomal proteins of bladder cancer cells
   107783884 (eIF-4A-10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII CMS1 AAA_22 AAA_19 DUF2780 AAA_30
Motif
Other DBs
NCBI-GeneID: 107783884
NCBI-ProteinID: NP_001312303
UniProt: P41382
Position
Un
AA seq 413 aa AA seqDB search
MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF
EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL
AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDMLRRQSLRP
DHIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMNKPVR
ILVKRDDVTLEGIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR
SRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQP
ENYLHRIGRSGRFGRKGVAINFVTKDDERMLSDIQKFYNVVIEELPANVADLL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggctggcttggcaccggaaggttctcagtttgatgctcgtcagtatgatgccaaaatg
actgagctgcttgggactgaacaggaggagttcttcacatcatatgatgaggtttatgac
agttttgatgccatgggtttgcaagaaaacctgcttaggggcatctatgcttatggtttt
gagaagccatctgctatccagcaaaggggtattgtcccattttgcaagggtcttgatgtg
atccaacaggcacaatccggaaccggaaagactgcaactttctgctctggagttctccag
cagcttgattacagcttagtcgaatgtcaggctctggttctggctccaacccgtgagctt
gcccaacagattgagaaggttatgcgagcacttggtgactatctcggtgtgaaggttcat
gcttgtgtaggaggtaccagtgtccgtgaagatcagcgtatccttcaaagtggtgttcat
gtggtggttggtactcctggccgtgtctttgacatgttgcgcaggcagtctcttcgccct
gaccacatcaagatgtttgttctggatgaagctgatgaaatgctctcaagaggtttcaag
gatcagatttatgatattttccaattgctaccaccaaagattcaagtgggtgttttctct
gccactatgccgccagaggcccttgaaattactaggaagttcatgaacaagcctgtgagg
attcttgtaaagcgtgatgacgttacgcttgaaggtatcaagcaattttatgtcaatgtt
gataaggaagagtggaagcttgaaactctttgcgatctttacgagaccttagccatcacc
cagagtgtcatctttgttaacaccaggcgtaaggttgattggctcactgacaaaatgcgc
agccgtgatcacacagtatctgcaactcacggagacatggaccagaatactagagatatc
attatgcgagagttccgatctgggtcgtcgcgtgtgctcatcaccactgatcttctggcg
cgtggtattgacgtgcagcaagtttcccttgtgattaactacgaccttccaactcagcca
gagaactatctgcatcgtattggtcgtagtggacgttttggaaggaagggtgttgctatc
aactttgtcacaaaggatgatgaaaggatgctttctgacattcagaagttttataatgtt
gtcatcgaggagttgccagccaatgtggccgatctcctttga

DBGET integrated database retrieval system