KEGG   Nicotiana tabacum (common tobacco): 107789681
Entry
107789681         CDS       T04643                                 

Gene name
THT10, THT30
Definition
(RefSeq) tyramine N-feruloyltransferase 10/30
  KO
K22246  tyramine N-feruloyltransferase [EC:2.3.1.110]
Organism
nta  Nicotiana tabacum (common tobacco)
Brite
KEGG Orthology (KO) [BR:nta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107789681 (THT10)
Enzymes [BR:nta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.110  tyramine N-feruloyltransferase
     107789681 (THT10)
SSDB
Motif
Pfam: Acetyltransf_1
Other DBs
NCBI-GeneID: 107789681
NCBI-ProteinID: NP_001312405
UniProt: P80969 A0A1S3ZRL9
Position
Un
AA seq 226 aa
MATTNNKNLTITEKVYVRVRLANEADISHIYKLFYQIHEYHNYTHLYKATESSLCDLLFK
ANPNPLFYGPSVLLLEVSPTPFENTKKDEKFKPVLKTFDLRATVEDKEAEEFKSKSCGDE
KEDVFIAGYAFFYANYSCFYDKAGIYFESLYFRESYRKLGMGGLLFGTVASIAANNGFAS
VEGIVAVWNKKSYDFYVNMGVEIFDEFRYGKLVGDALQKYADKEKV
NT seq 681 nt   +upstreamnt  +downstreamnt
atggctacaactaataacaaaaacctcactattactgaaaaagtttatgttagagttcgt
cttgcaaatgaagctgatatttcccatatatacaaactcttttaccaaattcatgaatat
cacaattacactcatctctacaaagccactgaatcttcactttgtgatcttctttttaaa
gcaaaccctaatcctctcttttatggaccatcagtacttttactcgaagtttcaccaacc
ccttttgaaaataccaaaaaagatgaaaaattcaagccagttttgaaaacatttgatctt
agagcaacagttgaggacaaagaagctgaggaatttaagtccaaatcatgtggagatgaa
aaggaagatgtttttattgctggatacgcgtttttttacgcgaattattcgtgcttttat
gataaagctgggatttattttgagagtctttattttagggagagttataggaagttagga
atgggaggtttgttgtttggaactgttgcttctattgctgcaaataatgggtttgcttca
gttgaaggaattgtggctgtttggaacaagaaatcttatgatttttatgttaatatggga
gttgaaatatttgatgaatttaggtatgggaagttggttggtgatgctctacaaaaatat
gctgacaaggagaaggtttaa

DBGET integrated database retrieval system