KEGG   Nicotiana tabacum (common tobacco): 107789799Help
Entry
107789799         CDS       T04643                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00010  Glycolysis / Gluconeogenesis
nta00562  Inositol phosphate metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107789799
   00562 Inositol phosphate metabolism
    107789799
Enzymes [BR:nta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107789799
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107789799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 107789799
NCBI-ProteinID: XP_016467152
UniProt: A0A1S3ZS08
Position
Un
AA seq 501 aa AA seqDB search
MLKLAMNLIILLLLTVFLGITPQSNADESSFDVRKHLATVSRYNVAKDISANSFVSSEIP
DQCTPLHLNLVARHGTRAPTKKKIRELEALAGHLEVLVRDAKEQKQSLEKIPAWLFGWSS
PWKGNLTGGELISEGEDELYHLGIRVGEKFPDLFSEEYHPDVYSIKTTQVPRASASAVAF
GMGLFNGRGKLGPGRHRAFAVTSESRASDIVLRFHDCCQSYKAFRKSRELNVDKLKEPVL
DEITRELVRQYGLSFTKQDVSSLWFLCKQEASLLNITNQACSLFSPSEVSLLEWADDLEL
FILKGYGDSLNYRMGVPLLEDVVHSMERAIKAKEEGYAPGTYEKARMRFAHAETLLPFSC
LIGLFLEEPEFELIQREQSLELPQKPPKTRNWRGSVVAPFAGNNMLVLYSCELDNSSKYF
VQVLHNERPIALPGCNSSSFCPFEVFKERIAAPHLKHDYNMLCNANMQQGQQNSASSKLS
QIFSWLFSLKNAGSSSQKVEL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagcttgctatgaatctcatcatactgcttctcctcactgttttcttagggatc
acgccacaatcaaacgccgatgaatcctccttcgatgttcgtaaacaccttgccactgta
tccaggtataatgttgccaaggacatatcagcgaattcattcgtatcttctgaaattcca
gatcaatgtacacctcttcatttgaatctagtggcaaggcatggcactcgtgcaccaacg
aagaaaaagataagggaattagaagccttggctggtcatttggaagtccttgtacgtgat
gcaaaagaacagaagcagtctttggagaaaattcccgcttggttatttgggtggagctct
ccttggaaaggaaatcttacaggtggagagttgatcagtgaaggagaagatgaattatat
catcttggaatcagagttggggaaaagtttccagaccttttcagtgaggaataccaccca
gatgtatattcaatcaagactacccaggttcctcgggcatcagctagcgctgtggcattt
gggatggggctatttaatggaagagggaagcttggaccaggaaggcatcgagcttttgct
gttaccagtgaaagccgtgcaagtgacatagttttgagatttcatgactgttgtcaaagc
tacaaggcttttagaaaaagtcgggagctaaatgtagacaagctcaaagaacctgtattg
gatgaaattactcgtgaattagtcaggcaatatgggcttagttttacgaaacaagatgta
tcttctttgtggtttctctgcaaacaggaagcatccttgttgaacatcaccaatcaagct
tgtagtctgttcagtccatctgaggtttctttgttggaatgggctgatgatttggagttg
ttcattctgaaaggctatggtgattcactaaattatcgaatgggagtgccactgctcgag
gatgttgtgcactcaatggaacgggcaattaaagctaaagaagaaggatatgctccaggg
acctatgaaaaggcaagaatgcgttttgctcatgcagaaactctgcttcccttttcatgc
ctgatcgggctctttcttgaagaacctgagtttgaactgatacaaagagagcaaagcttg
gaactcccgcagaagcctcctaaaactagaaactggcggggaagtgtagtggctcctttt
gccggaaataacatgttagtcctgtacagctgcgaattggacaactctagcaagtacttt
gtgcaagtgctacataatgaacgtcccatcgcattgccaggttgcaatagttcaagtttt
tgcccatttgaagtgtttaaggaaagaatagctgctcctcacttgaaacatgactataat
atgctttgcaacgcaaacatgcaacagggacagcagaattctgcttccagtaagttatca
caaatatttagttggcttttctcgctgaagaacgctggttcatcatctcagaaagtcgag
ttatag

DBGET integrated database retrieval system