KEGG   Nicotiana tabacum (common tobacco): 107792080
Entry
107792080         CDS       T04643                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00100  Steroid biosynthesis
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
Module
nta_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107792080
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107792080
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 107792080
NCBI-ProteinID: XP_016469754
UniProt: A0A1S3ZZH7
Position
Un
AA seq 369 aa
MDLNYLFNSLFPLWTSAAMLLSFFLYLATVGSILPGKLVPGVILSDGTRLHYRCNGLLSL
LLLVLLLGVGAQMNLVSPTAIADRGFELLSTTFIFSVLVTLMLYLAGCNSREKSSSLKPH
VSGNLIDDWWFGIQLNPNFIGIDLKFFFVRAGMMGWLLINLSVLAKCIIEAKLSQSIILY
QLFCGLYILDYFFYEEFMTSTWDIIAERLGFMLVFGDLVFIPFTFSIQGWWLLSNKVELT
TAAVIANCLVFLIGYLVFRGANKQKHMFKKNPKAPIWGKPPKVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSAVPYFYPIYLLILLIWRERRDEARCAEKYKDVWTEYRKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctcaattatctcttcaactcccttttccccttatggacttcggctgctatgtta
ctctcattctttctgtatttagcaactgttggatctatcctacccggaaaacttgttcct
ggtgtgattttatctgatggaactcgcctccattaccgttgcaatggtttgttatcactt
ttgttgttggttttgcttcttggagttggggcacagatgaatcttgtttcacctactgca
atagcagacagagggtttgagcttttgtccacaacatttatctttagtgttcttgtgaca
ttgatgctttatttggctggctgcaactcacgtgagaagagttcatcactgaaacctcat
gtctcaggaaatctaattgatgactggtggttcgggatacaactaaatcctaatttcatt
ggcattgatctcaaatttttctttgttagagctggtatgatgggatggttacttatcaat
ctttcagttcttgcaaaatgtattatagaggccaaattgagccaatcaataattctctac
cagctattttgtgggctgtacatccttgattacttcttctatgaagagttcatgacctcc
acatgggatataatagcagagagattgggcttcatgctggtttttggtgatctagtcttt
ataccgttcaccttcagtattcagggttggtggcttttgagtaacaaagttgagctaaca
acagcagcagtaattgccaattgcctcgtctttcttattgggtacttagtgttcagaggt
gccaacaagcagaagcatatgtttaaaaagaatcccaaggcacccatatggggtaagccc
ccaaaagttattggggggaagttgcttgcttctggctattggggcattgctcgacactgt
aattaccttggggacttgttgctggcattgtcatttagtttgccttgtgggataagttcc
gcggttccatacttttaccccatataccttcttattctgctaatatggagggagagaagg
gatgaagctcgatgtgcagagaagtacaaagatgtgtggacagaataccgtaaacttgtt
ccttggaggatcttaccttatgtttactag

DBGET integrated database retrieval system