KEGG   Nicotiana tabacum (common tobacco): 107792430Help
Entry
107792430         CDS       T04643                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00350  Tyrosine metabolism
nta00360  Phenylalanine metabolism
nta00380  Tryptophan metabolism
nta00950  Isoquinoline alkaloid biosynthesis
nta00965  Betalain biosynthesis
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107792430
   00360 Phenylalanine metabolism
    107792430
   00380 Tryptophan metabolism
    107792430
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    107792430
   00950 Isoquinoline alkaloid biosynthesis
    107792430
   00965 Betalain biosynthesis
    107792430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nta04147]
    107792430
Enzymes [BR:nta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     107792430
    4.1.1.105  L-tryptophan decarboxylase
     107792430
Exosome [BR:nta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107792430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 107792430
NCBI-ProteinID: XP_016470128
UniProt: A0A1S4A0G2
Position
Un
AA seq 509 aa AA seqDB search
MGSLDSNINSAQNQSTIAKFNPLDPEEFRTQAHQMVDFIADYYKNIENYPVLSQVEPGYL
RNRLPETAPYRPESFDTIMKDIQNHIVPGMTHWLSPNFFAFFPATVSSAAFVGEMLCTCF
NSVGFNWLASPAVTELEMVVMDWLANMLKLPKSFMFSGTGGGVLQGTTSEAILCTLIAAR
DRKLETLGVHNIGKLVVYGSDQTHSTYTKACKLAGIFPCNIRAIPTSVESNFSLSPVVLR
RVIEADMAAGLVPLFLCATVGTTSTTAVDPIGQLAEVANEHKIWLHVDAAYGGSACICPE
FRHYLDGIERADSLSLSPHKWLLSYLDCCCMWVREPNVLVKALSTNPEYLRNKRSEYESV
VDYKDWQIGTGRRFKSLRLWLVMRSYGIVNLQSHIRSDVRMAKMFEGFIKSDPRFEIVVP
RRFSLVCFRFNPVKESEPAYIELLNKKLLDSINSTGRVYITHTIAGGIYMLRFAVGATLT
EDRHVIAAWKLIKESADASLRRSYYYTTV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtcttgattcaaatattaatagcgctcaaaaccaatcaaccatagcaaaattc
aacccacttgaccctgaagaattccgtacacaagcccatcaaatggtggacttcattgct
gattattacaagaacattgaaaactaccctgttctaagccaagttgaaccgggttacctc
cgaaaccgattacccgaaactgccccatatcgccccgaatcatttgacaccattatgaaa
gatattcaaaaccatattgtccctggtatgactcactggttaagccctaatttctttgca
ttttttccagccaccgttagctccgctgctttcgtcggtgaaatgctgtgcacttgtttc
aactccgttggatttaactggctcgcgtcaccggctgttacggagctagaaatggtagtc
atggactggctcgcaaatatgctaaaactaccaaaatccttcatgttctccggcactggt
ggtggtgtacttcaaggtacaaccagtgaagctatcctctgtacactaatcgccgctcgt
gaccgaaagctcgaaaccctaggtgttcataatattggaaagctcgttgtttacggctct
gatcaaacgcactctacgtataccaaggcttgcaagctggctggtattttcccatgcaat
attagggctatacctacttctgttgaaagtaatttctctttatctcctgtggtcctacgt
agagttattgaagctgacatggctgctggattggtcccacttttcctctgtgctactgta
gggaccacttcaactacagccgttgaccctattggtcaactagctgaggtggctaatgag
cacaaaatctggctccacgtggatgctgcttatggaggcagtgcatgtatatgtccagag
tttagacattatcttgatggaattgaacgagctgactcgttgagtcttagtccacataaa
tggttactaagttacttagattgttgttgcatgtgggttagagaaccaaatgtgttggta
aaggcgttaagcactaatcctgaatatttgagaaataaacgatctgaatatgagtcagtt
gtagattacaaagattggcaaatcggtacaggtcgaaggttcaagtcgctccgattatgg
cttgttatgcgtagttatggcatagtcaatcttcaaagtcatattaggtctgatgttcga
atggccaagatgtttgaagggtttattaagtccgatccaaggtttgagattgttgtgccc
cggcggttttcgctcgtgtgcttccggttcaacccggtcaaagaatctgaaccggcatat
atcgagcttttaaacaagaagctgcttgattctatcaactcaaccgggcgagtttacatc
acacacacaatagcaggcggaatttatatgcttaggtttgcagtaggagccacacttaca
gaagacagacacgtaattgccgcttggaaattgataaaggagtcggccgatgcttcgctg
agaagaagttattattatactactgtttaa

DBGET integrated database retrieval system