KEGG   Nicotiana tabacum (common tobacco): 107793139Help
Entry
107793139         CDS       T04643                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00450  Selenocompound metabolism
nta00970  Aminoacyl-tRNA biosynthesis
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107793139
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107793139
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nta01007]
    107793139
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nta03016]
    107793139
Enzymes [BR:nta01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     107793139
Amino acid related enzymes [BR:nta01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   107793139
Transfer RNA biogenesis [BR:nta03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107793139
 Prokaryotic type
   Other AARSs
    107793139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 107793139
NCBI-ProteinID: XP_016470912
UniProt: A0A1S4A2K0
Position
Un
AA seq 616 aa AA seqDB search
MACRVQHSIHNSLYFLSSTPLRNSLNIRKSYFKSRINFGKTLFSSPSSSSRTALYCTCSS
SSSSNSGKDSLFTNGSDAFVLTTPLYYVNAPPHMGSAYTTIAADAIARFQRLLEKKVIFI
TGTDEHGEKIATAAAANGSSPSEHCDIVSQAYKALWKDFDISYDKFIRTTDPKHEAVVKE
FYSRVLANGDIYRADYEGLYCVNCEEYKDEKDLLDNNCCPTHLKPCVRRKEDNYFFALSK
YQQQLEEILRQNPGFVQPSYRLNEVQGWIKSGLKDFSISRASVDWGIAVPNDPKQTIYVW
FDALLGYVSALLEDNELASLETAISSGWPASLHLIGKDILRFHAVYWPAMLMSAGIGLPK
MVFGHGFLTKDGMKMGKSLGNTLEPTDLVQRFGPDAVRYFFLREVEFGNDGDYSEERFIN
VINAHLANAIGNLLNRTLGLLKKNCQSTLAVDSYVAAEGNKFKATVEKLVEKARVHYENL
ELSAACETVLEIGNAGNSYIDEQAPWSLFKKGETAFETAAKDLVIILEAMRIIAIALSPV
TPGLSLRIYSQLGYTEDQFNAVNWSDTKWGGLKAGQVMAQPTPIFARIEDATEAETKGAA
TKKVKKEKVPKSKSPV
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcagagttcaacactccattcataacagtctatatttcttatcttcaacccct
ttgcgcaattctttaaatataagaaagtcctatttcaagagtcgaattaactttggtaaa
actttgttttcatctccttcttcttcttcaagaactgcactttactgcacttgcagcagc
agcagcagcagtaacagtggtaaagatagtctttttacaaatgggagtgatgcatttgta
ctcacaactccactttattacgttaatgcccctcctcatatgggcagtgcttataccacc
attgctgctgatgccattgcccgttttcagaggctacttgagaagaaagttatattcatc
acaggcacagatgaacacggagagaagattgctactgcagctgcagctaatggttccagc
ccaagtgaacactgcgatattgtatcacaagcttataaagctctatggaaagattttgac
ataagttatgacaagtttatcagaacaactgatccaaaacatgaagctgttgtgaaggaa
ttttactctcgggttcttgccaatggcgacatatacagggctgattatgagggactttat
tgtgtcaattgtgaggagtacaaggacgagaaggatttgctggataataactgttgtcct
acacacttaaagccatgtgtgagaagaaaagaagataattacttctttgctttgtcaaag
tatcaacaacagttggaagaaattttaaggcaaaaccctggtttcgtgcagccatcttat
cgtctaaatgaggtccaaggttggattaaaagtggcctgaaagatttctctatttctcga
gcatcagtagattggggtattgcggttcctaatgatcctaagcagactatatatgtgtgg
tttgatgctttattgggttatgtatctgcacttttggaggataacgagctagctagttta
gaaactgcaatttcatctggatggcctgcctcactccacttaattggcaaggacatattg
cgatttcatgctgtttattggccagcgatgttaatgtcagcaggtattggccttcctaag
atggtatttggccatggattcttgaccaaggatggcatgaagatgggtaagtcactggga
aatacacttgaaccaacagacttggttcagaggtttggacctgatgcggtgaggtacttt
ttcctcagggaggtagaatttggtaatgatggtgactactcagaggaacggttcatcaac
gtcataaacgcacatttagctaatgcaattggtaatcttctaaaccgcacactcggacta
ctgaaaaagaactgccaatcaactctggcggttgattcatatgttgcggctgaaggaaac
aaattcaaggctacggtggaaaaactggtagagaaggcacgcgtgcactatgaaaatttg
gagttatcagcagcttgtgagactgtgctggagattggtaatgctggaaattcgtacatt
gatgaacaagcaccgtggtctcttttcaagaaaggggagacagcctttgaaactgcagca
aaggatcttgtgattatattggaagcaatgagaatcatagcaatcgcgctatccccagta
acgccaggcttaagcttgaggatatattcacaacttggctacactgaggaccaattcaat
gctgttaactggagtgataccaaatggggcgggctgaaagctggtcaggtaatggcacag
ccaacacctatctttgccagaatagaagatgcaactgaagcagaaaccaaaggtgcagca
acaaagaaagttaaaaaagagaaggtgccgaaaagtaagagtcctgtg

DBGET integrated database retrieval system