KEGG   Nicotiana tabacum (common tobacco): 107794186
Entry
107794186         CDS       T04643                                 

Gene name
NtPMM
Definition
(RefSeq) phosphomannomutase
  KO
K17497  phosphomannomutase [EC:5.4.2.8]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00051  Fructose and mannose metabolism
nta00520  Amino sugar and nucleotide sugar metabolism
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
Module
nta_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    107794186 (NtPMM)
   00520 Amino sugar and nucleotide sugar metabolism
    107794186 (NtPMM)
Enzymes [BR:nta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     107794186 (NtPMM)
SSDB
Motif
Pfam: PMM Hydrolase_3 S6PP
Other DBs
NCBI-GeneID: 107794186
NCBI-ProteinID: NP_001312503
UniProt: Q1W375
Position
Un
AA seq 252 aa
MAARKPGLIALFDVDGTLTAPRKEVTPEMLKFMKELRKVVTVGVVGGSDLVKISEQLGKT
VTTDYDYCFSENGLVAHKDGKLIGTQSLKSFLGDEKLKEFINFTLHYIADLDIPIKRGTF
IEFRSGMLNVSPIGRDCSQEERDEFEKYDKVHKIRQTMVSVLREKFAHLNLTFSIGGQIS
FDVFPQGWDKTYCLRYLEEFNEIHFFGDKTYKGGNDHEIYESERTVGHTVTSPEDTVKQC
SEQFLGKDNGSS
NT seq 759 nt   +upstreamnt  +downstreamnt
atggctgcaaggaagcctggtttaattgctctgtttgatgtcgatggaactcttacagca
cctcgcaaggaagttactccagaaatgttgaaatttatgaaggaacttagaaaggtggtt
accgtcggagttgttgggggttctgacctggttaagatatcagaacagcttggcaagaca
gttacaacggattatgattattgtttctctgaaaatggccttgtagcacataaggatggc
aagcttattggtacacagagcttgaagtcatttcttggagacgagaagctcaaggaattt
attaactttaccctccattacattgctgacttggatattccaataaagagaggaacattc
attgagttcagaagtggcatgctaaatgtctcacctatagggagggactgtagtcaggaa
gaacgtgatgaatttgagaagtatgacaaggtacacaagatacgtcaaacaatggtatct
gtgctcagagaaaagtttgcacaccttaacctcaccttctccattggaggccaaattagt
tttgatgtttttcctcaaggatgggacaagacttattgtttgagataccttgaagagttt
aatgaaattcacttttttggtgacaagacatacaagggaggaaatgaccatgagatctac
gagtccgagagaactgtgggtcacacagttactagcccggaggacacagtaaagcagtgt
tctgaacaattcctcggcaaggataatggaagttcttga

DBGET integrated database retrieval system