KEGG   Nicotiana tabacum (common tobacco): 107794892Help
Entry
107794892         CDS       T04643                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, chloroplastic-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00030  Pentose phosphate pathway
nta00480  Glutathione metabolism
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
nta01200  Carbon metabolism
Module
nta_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
nta_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    107794892
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107794892
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nta04147]
    107794892
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     107794892
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     107794892
Exosome [BR:nta04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   107794892
  Exosomal proteins of colorectal cancer cells
   107794892
  Exosomal proteins of bladder cancer cells
   107794892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 107794892
NCBI-ProteinID: NP_001312522
UniProt: O65856
Position
Un
AA seq 588 aa AA seqDB search
MGGQLQLNPCSSSSVATTFHNGAHKFCRNFNILPFKAHSLESSVASTFHNGIYSRIQPRK
HFEIMSSNGFHLNAVSLLDGSASKSMPEQVPLTELENAETTVSITVIGASGDLAKKKIFT
ALFALFYEDCLPENFIVFGYSRTKMSDEELRNMISKTLTCRIDQRENCEAKMDHFLERCF
YHSGQYHSEDDFAELDYKLKAKEGSRVSNRLFYLSIPPNIFVDVVRCASLKASSTSGWTR
VIVEKPFGRDLESSSELTRCLKKYLTEEQIFRIDHYLGKELVENLSVLRFSNLVFEPLWS
RNYIRNVQFIFSEDSGTEGRGGYFDNYGIIRDIMQNHLLQILALFAMETPVSMDAEDIRN
EKVKVLRSMRPLQLEDVVLGQYKGHSKGGKLYPAYTDDPTVPNGSVTPTFSAAALFINNA
RWDGVPFLMKAGKALHTRRAEIRVQFRHVPGNLYKRNFGTDLDKATNELVLRLQPDEAIY
LKINNKVPGLGMRLDRSDLNLLYKAKYRGEIPDAYERLLLDAIEGERRLFIRSDELDAAW
ALFTPLLKELEEKKIAPELYPYGSRGPVGAHYLAAKHNVRWGDLSGDD
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggcagttgcaattgaatccttgttcttcatcttcagttgctactactttccat
aatggggcacataagttttgcagaaattttaatattttaccatttaaagcccattccctt
gaatcttcagttgctagtactttccataatggaatttattcaagaatccagccaagaaag
cattttgagatcatgtcatcaaatggttttcatctgaatgctgtgtctttgctggatggt
tcggcgtcaaaatctatgccagaacaagtgcctttgacagagttagaaaatgcagagaca
actgtcagcataactgttattggagcttcaggtgacctagccaagaagaagattttcaca
gctttatttgctcttttctatgaagattgtttgcctgagaattttatagtttttggttat
tcacgaacaaaaatgagtgatgaagagctgagaaacatgatcagcaagaccttaacttgt
agaattgatcagagagagaattgcgaggctaaaatggaccactttctggaaagatgcttt
taccactccggtcagtaccattctgaggatgattttgcagaactggattacaaattaaag
gcaaaggaggggtctagggtttctaataggttgttttacttatcaatacctccaaatata
ttcgtggatgtggtgagatgtgcaagtcttaaagcttcttcaacaagtgggtggacaaga
gtcattgttgagaaaccgtttggtcgtgacttagaatcatctagtgagctgaccagatgc
ctaaagaagtatctaactgaggagcaaatattccgaattgaccattacttgggaaaggaa
cttgttgagaatctctcagttcttcgtttctcgaatcttgtctttgagcctctctggtcc
agaaactacatacgcaatgtccaattcatattttccgaggactctggtaccgagggacga
ggagggtactttgacaattacgggatcatccgagatataatgcaaaatcatctccttcaa
atattagcattgtttgctatggaaacacctgtcagcatggatgccgaggacatcagaaat
gaaaaggttaaagttttaaggtcaatgaggccattgcagcttgaagatgtggtacttggc
cagtataaaggtcatagcaagggtggtaaattatatccagcttatacagacgatccaact
gtgccaaacggtagtgtcactccaacgttttctgctgctgcactctttattaataatgca
cgctgggacggcgttcctttcctcatgaaagctggaaaagctctccatactaggagggcg
gagatcagggtacagttcagacatgttcctggaaatttgtacaaaaggaactttggaact
gatctagataaggccacaaatgagctagttctgcgcttacaacctgatgaagccatatat
ctgaagatcaacaacaaggttcctggtcttggaatgagacttgaccggagtgaccttaat
cttctttacaaagcaaagtatcgaggtgaaataccagatgcatatgagcggcttctgtta
gatgcaatagaaggagagcgaagattgttcattagaagtgatgagctggatgctgcatgg
gctctatttacaccattgctgaaggagctagaagagaagaagattgcgccagagctttat
ccgtatggcagtaggggtccagtaggagcacattatctagctgcaaagcacaacgttcgt
tggggagatctgtctggtgatgattga

DBGET integrated database retrieval system